OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 32.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"x-ray microscope"×
Temperature and Heat Flow×

Maps, Models and Data from Southeastern Great Basin PFA

Jun 30, 2017
846.11 kB
Publicly accessible
This submission includes composite risk segment models in raster format for permeability, heat of the earth, and MT, as well as the final PFA model of geothermal exploration risk in Southwestern Utah, USA. Additionally, this submission has data regarding hydrothermally altered are...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyexplorationplay fairway analysisutahheatpermeabilityopalmtmagnetotelluricpfahydrothermal alterationsinterhidden geothermal systemsblind geothermal systemsshapefileshape filearcgisgisgeospatial dataxrdx-ray diffractionmilfordphase 2segbgbgreat basinse great basineasterngeophysicsheat floweastern great basinhydrothermal

Utah FORGE: Well Data for Student Competition

Dec 07, 2018
33.96 MB
Publicly accessible
Well 58-32 (previously labeled MU-ESW1) was drilled near Milford Utah during Phase 2B of the FORGE Project to confirm geothermal reservoir characteristics met requirements for the final FORGE site. Well Accord-1 was drilled decades ago for geothermal exploration purposes. While ...
Authors
Podgorney, R. et al Idaho National Laboratory
geothermalenergyforgestudent competition58-32accord-1egsroosevelt hot springsmilfordutahreservoir characteristicswell loggeophysicalgeophysicslithologythermal conductivityx-ray diffractionwell surveysonicwell locationsdensitycaliperhole diametergammagrradiationresistivityneutronporositysptemperatureconductivityspecific potentialmu-esw1welldatawell dataresourcecharacterizationexplorationutah forge

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Well 16A(78)-32 Logs

Mar 08, 2021
10.01 GB
Publicly accessible
This dataset contains all well logs from Utah FORGE well 16A(78)-32. This includes the mud log, Sanvean Technologies logs, and Schlumberger logs. Please see the file descriptions below for information about each log.
Authors
Gilmour, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32 drilling logsutah forgeforgewell 16a78-32 sanvean logswell 16a78-32 schlumberger logswell 16a78-32 mud logutah geothermalwell dataloggingmud logsanvean logsschlumberger logs16a78-32well logegssanveanschlumbergerlithologyfmiformation microimagerfullborewellborecorecharacterizationdrillgeologydrill ratemineralstemperaturerate of penetrationropdrill stem test

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Utah FORGE: Milford Digitized Geophysical Logs from Acord 1

Mar 31, 2016
133.55 MB
Publicly accessible
This submission includes digitalized versions of the following: McCulloch Geothermal Corp Acord 1-26 Cover Letter McCulloch Geothermal Corp Acord 1-26 Drilling Plan McCulloch Geothermal Corp Acord 1-26 Bond Documents Division of Water Rights Permission to Drill Drillers Log Geot...
Authors
Jones, C. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsmilfordutahwell datawater rightsacordaccordlogwelldatageophysicsgeophysicalwell logacord 1digitizeddrilling plandrillers logmud logneutron logcompensated densilogbhc acoustilogtemperaturedifferential temperaturedual inductionfocused loggamma raydensilogreport of well drillerstratigraphystratigraphic reportphotographycuttingsresourcecharacterizationroosevelt hot springsdrilling

Utah FORGE: Well 14-2 Logs and Data from Roosevelt Hot Spring Area

Mar 03, 2016
96.02 MB
Publicly accessible
This is a compilation of logs and data from Well 14-2 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Data includes: flowmeter survey (1989), geochemistry (1977-1978, 1977-1983), injection test data (1979, 1982), and spinner surveys (19...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermal wellsutah well logswell logsgeothermal wellsgeothermal well logsutah egsgeophysicsdownholeboreholemud logspinner surveyinjection testgeochemistryflowmeter testsonicgammaporositytemperaturepressuresurveysubsurfaceinductioncalipercompensated neutronformation densityutahwell datawell log14-2resourcecharacterizationmilfordroosevelt hot springsflowmeterspinnergamma raycompensatedneutronformationdensityelectricsteam injection

Hawthorne Nevada Deep Direct-Use Feasibility Study Data Used for Geothermal Resource Conceptual Modeling and Power Capacity Estimates

Apr 05, 2020
4.1 MB
Publicly accessible
This data submission includes several data components that were used to develop a conceptual model and power capacity-estimates of two low-temperature geothermal resources that define geothermal prospect A at Hawthorne, Nevada. Data are sourced from a combination of legacy publicl...
Authors
Ayling, B. and Hinz, N. Great Basin Center for Geothermal Energy
geothermalenergyhawthornegeochemistryconceptual modeltemperature logsborehole fracture datahawthorne army depotdirect usenevada2-meter temperaturesalteration mineralsptswell datafluid chemistryddutemperaturefracturexrdwater chemistrysurveycuttingsmodelingcapacityestimatesconceptualhwaad-2hwaad-3hwaad-2ageospatial datalow-tempertaurehydrothermalseservoireservoir compartmentalizationpower capacityimage log

Utah FORGE: Well Acord 1-26 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
91.14 MB
Publicly accessible
This is a compilation of logs and data from Well Acord 1-26 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Logs include: mud log (45'-12645'), compensated densilog (1102'-7923', 7900'-12644'), neutron log (1102'-7923'), dual induction ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egswell logsutah well logsgeothermal wellsutah geothermal wellsroosevelt hot springsroosevelt hot springcement bondgamma rayneutronporositycompensated densilogstratigraphic reportstratigraphypetrographydual inductionacousticacoustilogdensitytemperature logdifferentialsamplegeothermcalipermud logdrillers logwater rightspermission to drilldrilling planbond documentsacordutahacord 1-26well logwell dataresourcecharacterizationmilfordtemperaturedensilogcompensatedcuttings

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Fallon FORGE: Well Temperature Data

Mar 01, 2016
4.99 MB
Publicly accessible
x,y,z downhole temperature data for wells in and around the Fallon FORGE site. Data for the following wells are included: 82-36, 82-19, 84.31, 61-36, 88-24, FOH-3D, FDU-1, and FDU-2. Data are formatted in txt format and in columns for importing into Earthvision Software. Column he...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallontemperaturewell datadownholeboreholewelldatanevada

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Publicly accessible
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater

Utah FORGE: Well 9-1 Logs and Data from Roosevelt Hot Springs Area

Mar 03, 2016
166.63 MB
Publicly accessible
This is a compilation of logs and data from Well 9-1 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to the...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermalgeothermal wellswell logsutah well logsmilfordtemperaturemulti-shotdirectionalgeochemicalammoniasilicaanalysisdaily report1975core logacoustic cement bondcompensated sonicboreholedensilogformation densitydownholegeophysicsgeophysicalsurveygamma rayneutronporosityinductionmudsubsurfacewell logwell datautah9-1resourcecharacterizationroosevelt hot springs

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Utah FORGE: Well 78B-32 Daily Drilling Reports and Logs

Aug 09, 2021
11.89 GB
Publicly accessible
This data set includes the daily drilling reports and Pason data for well 78B-32 and Schlumberger logs acquired after drilling completion. This well was drilled between June 27th and July 31st of 2021. Also included is raw and processed data for a variety of well data metrics incl...
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 78b-32well 78b-32 fmi logswell 78b-32 ubi logswell 78b-32 drilling datautah forge well 78b-32daily reportsdaily drilling reportsprocess dataraw datagamma rayporositylogscementtemperaturedensityresistivityfractureubifmisonicwell databoreholewelldatagammadrillingreportscblcement bond logpason data

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Material Properties for Brady Hot Springs Nevada USA from PoroTomo Project

Mar 06, 2019
242.91 MB
Publicly accessible
The PoroTomo team has completed inverse modeling of the three data sets (seismology, geodesy, and hydrology) individually, as described previously. The estimated values of the material properties are registered on a three-dimensional grid with a spacing of 25 meters between nodes....
Authors
Feigl, K. and PoroTomo Team, . University of Wisconsin
geothermalenergyporotomoseismologygeodesyhydrologynevadabrady hot springsporoelastic tomographyinversionmodeling3dmaterialpropertiesunconsolidatedfracturedshallowstructuraltrendsgeologystrikedipthermal contractionpressuresubsidencepumpinghydraulic conductivityrateseismic amplitudefaultzonepermeableconduitfluidreservoirconceptualmodelpropertydensityp-waves-waveseismicvelocityyoungs moduluspoissons ratiointerferometrytemperaturelithologystrain rate

Utah FORGE: Well 82-33 Logs and Data, Roosevelt Hot Spring Area

Mar 03, 2016
74.2 MB
Publicly accessible
This is a compilation of logs and data from Well 82-33 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgeutah egsroosevelt hot springgeothermal well logswell logsutah well logsgeothermal wellsutah geothermal wellsroosevel hot springbottom hole pressurecasing schematiccleanoutsdirctional surveygeochemistrygeology loginjection cpaacitymorning reportsplan of operationsspinner surveyinjection testwater analysiswater chemistrycompensated soniccalipercement bondcollar logcompensated neutronformation densitydifferential temperaturegamma raymud loginductionpressure surveytemperature surveywell logwell data82-33utahresourcecharacterizationmilfordroosevelt hot springs

West Flank Coso FORGE: 3D Temperature Model

Mar 01, 2016
603.86 kB
Publicly accessible
x,y,z data of the 3D temperature model for the West Flank Coso FORGE site. Model grid spacing is 250m. The temperature model for the Coso geothermal field used over 100 geothermal production sized wells and intermediate-depth temperature holes. At the near surface of this model,...
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flankcosotemperaturetemperature gradientcaliforniamodel3d

Fallon FORGE: Lithology Logs and Well 21-31 Drilling Data

Mar 11, 2018
128.85 MB
Publicly accessible
This submission includes lithology logs for all Fallon FORGE area wells; determined from core, cuttings, and thin section. Wells included are 84-31, 21-31, 82-36, FOH-3D, 62-36, 18-5, 88-24, 86-25, FOH-2, 14-36, 17-16, 34-33, 35A-11, 51A-20, 62-15, 72-7, 86-15, Carson_Strat_1_36-3...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyfallonforgeegsnevadalithologywellscorecuttingsdepth intervalsgeologyvetted-nodrill logwell loggeologic unitextentnvdrillingloggingmud reportdrilling parametersmud lossesdirectional drillingwireline logsfracturesmineralsmineralogytemperaturegasesgamma raygamma radiationself potentialspontaneous potentialresistivitynphole diametersphi21-31datawelllog

Utah FORGE: Logs and Data from Deep Well 58-32 (MU-ESW1)

Apr 11, 2018
2.24 GB
Publicly accessible
Data, logs, and graphics associated with the drilling and testing of Utah FORGE deep test well 58-32 (MU-ESW1) near Roosevelt Hot Springs.
Authors
Nash, G. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutahgeothermal welltest welldrillinggeothermal drillingdrilling datawell testingwell test datafmi logsdsi logsgamma logsporositycaliper logsdaily reportstemperature logspressure logsisolation scannersonic logsmud logsdirectional surveypason logsborehole stresspt reportswell logsmu-esw158-32roosevelt hot springslogdatadeppwellcaliperegswell logtestingmilfordwell dataresourcecharacterizationtemperaturepressuredeep wellpason dataeowrend of well report

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service