OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 447.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"geothermal reservoir"×
Archive×

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

Deep Direct-Use Feasibility Study Reservoir Productivity Uncertainty Analysis for the Tuscarora Sandstone, Morgantown, WV

Dec 19, 2019
10.81 MB
Publicly accessible
This dataset contains figures that summarize the Tuscarora Sandstone core permeability data collected from the Preston 119 well in Preston County, WV, and summary results of a stochastic analysis that was used to estimate reservoir productivity for the currently unexplored Tuscaro...
Authors
Smith, J. West Virginia University
geothermalwvucornell universityappalachian basintuscarora sandstonereservoir flow geometryreservoir productivity assessmentpermeabilitymatrixfractureuncertainty analysisreservoir productivity indexreservoir flow capacityrpirfcmonte carlo analysiscodeddudeep direct-usefeasibilityfavorabilityeasterneastuncertaintyegsshapefilesgeospatial data

Fallon FORGE: Distinct Element Reservoir Modeling

Mar 12, 2018
57.97 MB
Publicly accessible
Archive containing input/output data for distinct element reservoir modeling for Fallon FORGE. Models created using 3DEC, InSite, and in-house Python algorithms (ITASCA). List of archived files follows; please see 'Modeling Metadata.pdf' (included as a resource below) for addition...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyegsforgefallonnevadastresshydro-shearinghydraulic fracturesgeomechanicsthermalmicroseismicitygeometrycirculationstimulationreservoir modelvetted-nopython codescriptmicroseimicwell trajectoriesfracture aperturehydroshearingstereonet plotspercent fracture slip vs pressureinjectionstressesdfngeologic structurejoint networkleakoff ratioshear stimulatedshear displacementnormal displacementopenholecasedthermal drawdownseismicitywell locationsreservoir mappingmiocroearthquakesmeqthermal modelingfracture tendancymicroseismicanalysisanalysesmodellingmodelreservoir

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
1.27 GB
Publicly accessible
The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal energy production. Phase 1 includes reservoir analyses to determine injector/producer well schemes that balance the generation of economically useful flow rates at the ...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageco2 injectionpressure managmentpressure supportartesian well flowheat extractionco2 cutpressure management

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
475.12 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk : FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageco2 injectionheat extractionpressure managmentpressure supportartesian well flowco2 cutsedimentarypressure managementworking fluid

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
979.58 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk : FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportco2 injectionartesian well flowheat extractionco2 cutsedimentarybrine reinjection

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2000
609.93 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageheat extractionpressure managementpressure supportartesian well flowco2 cutworking fluidco2 injection

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

University of Illinois Campus Deep Direct-Use Feasibility Study Preliminary Geothermal Reservoir Model

May 08, 2018
11.31 GB
Publicly accessible
Preliminary geothermal reservoir simulations were performed using a homogeneous static model to evaluate and understand the effects of fluid and rock properties that could influence the delivery of thermal energy in a doublet system. A 5000 feet by 5100 feet by 500 feet homogeneou...
Authors
Okwen, R. University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoisillinois basinreservoir modelstatic modelvip landmark

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
34.45 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal ...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportworking fluidheat extractionco2 cutsedimentary

Machine Learning-Assisted High-Temperature Reservoir Thermal Energy Storage Optimization: Numerical Modeling and Machine Learning Input and Output Files

Apr 15, 2022
113.79 MB
Publicly accessible
This data set includes the numerical modeling input files and output files used to synthesize data, and the reduced-order machine learning models trained from the synthesized data for reservoir thermal energy storage site identification. In this study, a machine-learning-assiste...
Authors
Jin, W. et al Idaho National Laboratory
reservoir thermal energy storagestochastic simulationgeotesmachine learningmodelingtesht-rtescharacterizationnumerical modelstochastichydrogeologic formationsimulated datasimulation datahigh-temperaturethermal energy storageoptimizationartificial neural network regressionannneural networkoperation scenariosseasonal-cyclepareto frontsseasonal operationcontinuous operationfalconmoose

Geothermal Reservoir Simulation Results in support of Feasibility Study of Direct District Heating for the Cornell Campus Utilizing Deep Geothermal Energy

Oct 29, 2019
1.62 GB
Publicly accessible
This dataset contains input data, code, ReadMe files, output data, and figures that summarize the results of a stochastic analysis of geothermal reservoir production from two potential geothermal reservoirs that were evaluated for the Cornell University Deep Direct-Use project. Th...
Authors
Smith, J. and Beckers, K. Cornell University
geothermalenergycornell universitylow-temperature geothermalreservoir simulationuncertainty analysistechno-economic analysisdirect-use heatingdistrict heatingnew york stateheat pumpslevelized cost of heat lcohexternality valuesenvironmental valueeconomic valuedirect usedducornelltrenton-black rivertough2petrasimmonte carlo analysismonte carlogeophiresstochastic analysis

Subsurface Characterization and Machine Learning Predictions at Brady Hot Springs Results

Oct 20, 2021
6.41 MB
Publicly accessible
Geothermal power plants typically show decreasing heat and power production rates over time. Mitigation strategies include optimizing the management of existing wells increasing or decreasing the fluid flow rates across the wells and drilling new wells at appropriate locations. Th...
Authors
Beckers, K. et al National Renewable Energy Laboratory
geothermalenergymachine learningmlsubsurfacecharacterizationbrady hot springsbhspredictionreservoir modelingtime seriespcaprincipal component analysisreservoir managementreservoirdual-porositystimulationinjection testpdetemperatureflowpressuresimulationsingle-fracturedoubletheat maptensorflowcnnlstmmlphydrothermalopen source reservoirosrnevada

Appalachian Basin Play Fairway Analysis: Revised 2016 Combined Risk Factor Analysis

Nov 15, 2016
26.7 MB
Publicly accessible
This submission contains information used to compute the combined risk factors for deep geothermal energy opportunities in the Appalachian Basin, in the context of a the Play Fairway Analysis project. The risk factors are sedimentary rock reservoir quality, thermal resource qualit...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginiapennsylvanianew yorkdeep direct usedistrict heatinggeothermal play fairway analysisgpfa-ablow-temperaturecombined risk segment mapsrisk analysisrisk factormapgeologicthermalreservoirseismicutilizationseismicitythermal qualitiesrastertiffgeotiffgeospatial datalow temp

Utah FORGE: EGS Reservoir Produced Fluids Geochemistry 2022-2024

Feb 26, 2025
1.38 MB
Publicly accessible
This dataset contains geochemical analyses of produced fluids from the Utah FORGE site, specifically from wells 16A(78)-32, 16B(78)-32, and 58-32, collected during various stimulation, flowback, and circulation tests conducted between 2022 and 2024. The data contains element conce...
Authors
Simmons, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegeochemistryproduced fluids16a78-3258-32circulation testsstimulationflowback waterflowback watersstimulation testsegsreservoir monitoringdissolved gasesmineral dissolutionfluid chemistrybrine compositionchemical geothermometry16b78-32

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis

Deep Direct-Use Feasibility Study Estimation of Reservoir Properties for the Tuscarora Sandstone

Dec 19, 2019
56.41 MB
Publicly accessible
This dataset contains black-and-white photographic images of individual core segments from well Preston 119 and photomicrographs taken of petrographic thin sections from well Clay 513. Minipermeameter measurement results of 2,260 samples for fracture and matrix permeability on cor...
Authors
McDowell, R. West Virginia University
geothermalappalachian basinwvuwvgestuscarora sandstonethin section analysisminipermeameterpermeabilityddudeep direct-usematrix permeabilitycore segmentsfracture analysisreservoir analysisphotomicrographsfracture permeabilityfeasibilityreservoirgeologicthermalpropertiesthicknessdepthcharacterizationwvegs

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Large Scale Grid

Feb 26, 2021
248.07 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modeling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, on ...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcesimulationflowcfdflow simulationmodelreservoir coolinginjectionreservoir cooling systemaquifer storage cooling systemgroundground coolinggeothermal coolingreservoirnew jerseystockton universitywithdrawalfea

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

InSAR Maps of Deformation Covering Raft River, Idaho from 2007 to 2010

Mar 11, 2007
196.13 MB
Publicly accessible
This dataset contains maps of deformation covering Raft River, Idaho from 2007 to 2010 calculated from interferometric synthetic aperture radar data. This dataset is used in the study entitled "Inferring geothermal reservoir processes at the Raft River Geothermal Field, Idaho, US...
Authors
Reinisch, E. University of Wisconsin
geothermalenergyraft river geothermal fieldinsarenvisatsatelliteinterferometric synthetic aperture radaregsreservoir developmentreservoir modeling

Utah FORGE: Reports on Northwestern Nevada Well Doublet Drilling and Testing by Fervo Energy

Sep 05, 2023
17.51 MB
Publicly accessible
These reports review Fervo Energy's construction of a commercial enhanced geothermal system (EGS). Fervo has qualified full functionality of the system through production testing at commercially relevant operating conditions. The project site is located in a nearfield setting ad...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyfervo energynevada egsenhanced geothermal systemsegshorizontal drillingplug-and-perfutah forgecross-well strainplug-and-perforationhorizontal doubletblue mountainnevadafiber optic sensingwell stimulationfracingfrackingreportdoublet well systemdistributed fiber optic sensingdfosfeasibilityassessment

Utah FORGE: Earth Model Native State Simulation Results

Jul 16, 2019
6.69 MB
Publicly accessible
Utah FORGE phase 2C Native State Simulation zip contains the data used for the boundary conditions and subsequent native state simulation results obtained using the simulation code FALCON. Data are from the nodes of the simulation domain, with used a uniform 50m spacing over a 250...
Authors
Podgorney, R. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutah geothermalnative state simulationfalconearth modelsimulationmilfordroosevelt hot springsegsanisotropic permeability and porositypermeabilityporositynative statedfnidaho national laboratoryinlmodelingmodellingreservoirparametersproperties

Utah FORGE 3-2417: Simulation Meshes and Results from Extended Circulation and Pulse Interference Testing

Sep 05, 2025
6.17 MB
Publicly accessible
This dataset contains numerical simulation meshes and modeling results from extended circulation and pulse interference tests conducted between Utah FORGE wells 16A(78)-32 and 16B(78)-32. The simulations were performed as part of the FOGMORE Utah FORGE project (Fiber Optic MOnitor...
Authors
Lee, S. and Ghassemi, A. Rice University
geothermalenergyutah forgeegsfogmoresimulationmeshreservoir modelingextended circulation testpulse interference testnumerical simulationmesh datapressure distributiontemperature distributionpermeability modelingstress-dependent permeabilitydiscrete fracture networkdfnfiber optic monitoring16a78-3216b78-32paraviewmodelmodel filesmodel results
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service