OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 113.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"pressure gradient"×
Archive×

West Flank Coso FORGE: Well 74-2TCH Temperature, Pressure, Well History, Well Bore Schematic

May 13, 2016
58.79 MB
Publicly accessible
Temperature logs, pressure logs, directional survey, well history, well bore schematic, and other reports for well 74-2TCH at West Flank FORGE
Authors
Blankenship, D. Sandia National Laboratories
geothermalwelltemperature logforgeegsmud logdaily reportsdrill rigstatic surveywell completionsurvey plotssundry noticetemperature gradientpressure gradientthin sectionswell historywellbore schematicwell schematichistoryschematictemperaturepressure74-2tchlogcoso

West Flank Coso FORGE: Well 48-11TCH Temperature, Pressure, Directional, Well History, Wellbore Schematic

May 13, 2016
41.29 MB
Publicly accessible
Temperature logs, pressure logs, directional survey, well history, well bore schematic, and other reports for well 48-11TCH at West Flank FORGE
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgewell datatemperature logsmud logswest flankdaily drilling reportswell loghydrothermal veinshydrothermal clay abundanceresistivitylithologybreccia zonesdirectional surveystatic surveywell historywellbore schematicwell schematicbottomholegeothermal exploration permitsundry noticegradientservice reportloggingwell completionwellborecosotemperaturepressuredirectionalwellhistoryschematic48-11tchdata

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
97.37 MB
Publicly accessible
This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egsroosevelt hot springutah geothermal wellswell logsutah well logsutah geothermalgeothermal well logsroosevelt hot springswater analysiswater qualitygeochemistryflow samplewireline samplepressure surveytemperature surveysubsurfacehistorywell schematicsite mapwell locationscasing schematicwell completionbhtgradienthydrothermal alterationcompensated soniccompensated neutronformation densityporositylaterlogdual inductionelectromagneticelectro-magneticthickness toolfracture identificationmud logcaliperboreholedownholegeophysicssurveygeophysicalgeochemicalwell datautah52-21well logresourcecharacterizationmilford

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Deep Direct-Use Feasibility Study Numerical Modeling and Uncertainty Analysis using iTOUGH2 for West Virginia University

Dec 20, 2019
384.67 MB
Publicly accessible
To reduce the geothermal exploration risk, a feasibility study is performed for a deep direct-use system proposed at the West Virginia University (WVU) Morgantown campus. This study applies numerical simulations to investigate reservoir impedance and thermal production. Because of...
Authors
Garapati, N. et al West Virginia University
geothermalwvutuscaroraitough2lbnlreservoir flow modelpermeabilityfracturematrixuncertainty analysisnumerical modelingmonte carlofirst-order-second-moment uncertainty propagation analysisfeasibilityddudeep direct-usemorgantownreservoir impedancethermal productionresource potentialthermal breakthroughpermeability modelseconomic analysispapergeothermicsgeothermal exploration riskexploration riskmodelingeconomicdirect usewest virginia universitytuscarora sandstoneflow modeluncertaintyanalysissimulationflow

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Penrose Well Temperatures

Mar 15, 2013
6.69 kB
Publicly accessible
Penrose Well Temperatures Geothermal waters have been encountered in several wells near Penrose in Fremont County, Colorado. Most of the wells were drilled for oil and gas exploration and, in a few cases, production. This ESRI point shapefile utilizes data from 95 wells in and a...
Authors
Christopherson, K. Flint Geothermal, LLC
geothermalcoloradofremont countytemperature gradientsoil and gas wellstemperature gradientpoint shapefileshapefileshape filewell datatemperaturepenrose welldatageospatial data

Tularosa Basin Play Fairway Analysis: Partial Basin and Range Heat and Zones of Critical Stress Maps

Nov 15, 2015
3.06 MB
Publicly accessible
Interpolated maps of heat flow, temperature gradient, and quartz geothermometers are included as TIF files. Zones of critical stress map is also included as a TIF file. The zones are given a 5km diameter buffer. The study area is only a part of the Basin and Range, but it does inc...
Authors
Brandt, A. University of Utah
geothermalfort blisstularosa basintularosanew mexicocritical stressquartz geothermometerheat flowheatflowtemperature gradientmapsmapbasin and rangegreat basinutahnevadainterpolationextrapolationquartzgeothermometertemperaturegradientzonesfaultpermeabilitypfaplay fairway analysisgeothermometrygeospatial data

Washington Play Fairway Analysis Geothermal Heat and Permeability Potential Geodatabases

Dec 15, 2015
309.26 MB
Publicly accessible
This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeli...
Authors
Norman, D. et al Washington Division of Geology and Earth Resources
geothermalmount st. helens seismic zonewind river valleymount bakerpermeabilityheatfavorabilityuncertaintyrisksensitivityplay-fairwaywashingtoncascade rangeslip tendencydilation tendencysigma 3maximum coulomb shear stressdisplacementdisplacement gradientmaximum shear strain ratedilational strain ratefaultvolcanic ventintrusive rocktemeprature gradientgeothermometryhot springfumarolegeothermal favorabilitystrain rategisarcgisgeospatial datageodatabasegdbwashington statepfa

Porotomo: InSAR Data from San Emidio Geothermal Field, Nevada, 1992-2010

Jun 25, 2019
219.34 MB
Publicly accessible
This submission contains tarred pair directories for interferometric synthetic aperture radar (InSAR) data covering San Emidio Geothermal Field in Nevada, USA as part of the porotomo project. Data included within this submission are the following: > ENVI_T120_GDR.tgz: Tarred direc...
Authors
Reinisch, E. and Feigl, K. University of Wisconsin
geothermalenergysan emidiointerferometric synthetic aperture radarinsarenvisatenviersdemremote sensinginterferometricsynthetic aperture radarpairdigital elevation modelsatellitedeformationporotomonterferometric synthetic aperture radarinterferogramsgmt5sargoldstein filteruniversal transverse mercatorraw synthetic aperture radarsarwinsarunavcoeuropean space agencysqueesareasting gradient filesgeospatial data

Colorado Heat Flow Data from IHFC

Feb 01, 2012
5.73 kB
Publicly accessible
This layer contains the heat flow sites and data of the State of Colorado compiled from the International Heat Flow Commission (IHFC) of the International Association of Seismology and Physics of the Earth's Interior (IASPEI) global heat flow database. The data include different i...
Authors
E., R. Flint Geothermal, LLC
geothermalihfccoloradoheat flow dataarcgisgisshapefileshape filegeospatialgeospatial datatemperaturedatatemperature gradientgeophysicsheat flowthermal conductivityconductivityheat generation

Lightning Dock Geothermal Field Data Package, Hidalgo County, New Mexico

Aug 19, 2026
7.4 GB
Publicly accessible
This submission is a curated geoscience, well and plant-operations data package for the Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico, a liquid-dominated system produced for binary (ORC) power generation. It covers well-by-well data...
Authors
Ifrene, G. et al Zanskar Geothermal
lightning dockwell logsgisproduction datageothermalenergytracer testpower generationgeochemistrygeophysicsgroundwaterbinary systemorcdownhole temperaturebouguermagnetotelluricinversion modelsaeromagneticsgravity surveylidarquaternary faultgeologymud logstemperature

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Hawthorne Nevada Deep Direct-Use Feasibility Study Temperature and Geochemistry Well Data

Mar 29, 2018
1.06 GB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotwell datamonitoringgreat basin center for geothermal energygbcgetgtemperature gradientdduhawthorne

Alum Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
252.81 MB
Publicly accessible
Data generated from the Alum Innovative Exploration Project, one of several promising geothermal properties located in the middle to upper Miocene (~11-5 Ma, or million years BP) Silver Peak-Lone Mountain metamorphic core complex (SPCC) of the Walker Lane structural belt in Esmera...
Authors
Miller, C. Ram Power, Inc.
geothermalgravitymagneticsmtgeochemistryregional temperatureresource modelwell datageologyupper miocenesilver peaklone mountainwalker lanealumesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countygrav-magmagnetic3dprofileprofilesround 12009round 22010magnetotelluricsinversion30 ohm100 ohm300 ohmztemchemistrygeothermometrytemperaturehole 56-29historicshallowwell logsmoderngeologicgeomechanicsgeophysical25-2926-19geologyreportexecutive summarymapssectionsphotosphotographspicturesgeospatial data

Utah FORGE 2439: A Multi-Component Approach to Characterizing In-Situ Stress

Dec 13, 2022
201.16 MB
Publicly accessible
Core-based in-situ stress estimation, Triaxial Ultrasonic Velocity (labTUV) data, and Deformation Rate Analysis (DRA) data for Utah FORGE well 16A(78)-32 using triaxial ultrasonic velocity and deformation rate analysis. Report documenting a multi-component approach to characterizi...
Authors
Bunger, A. et al Battelle Memorial Institute
geothermalenergyutah forgein-situ stresslaboratorymodelingfield measurementtuvtriaxial ultrasonic velocitydeformation rate analysisdraweight of evidencewoeegsstress testcharacterizationwell datageophysicsforge16a78-32

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Utah FORGE: Wells Updated Temperature and Pressure Logs (June 2021)

Jun 29, 2021
3.25 MB
Publicly accessible
This dataset includes updated temperature and pressure logs for Utah FORGE wells 56-32, 78-32, and 58-32. This data was acquired in June 2021.
Authors
Stout, F. Di Drill Survey Services
geothermalenergyutah forgewelllogstemperature pressure logswell 58-32well 56-32well 78-32temperaturepressuredataraw dataprocessed datautahforgeegs

Utah FORGE: Well 16B(78)-32 Pressure-Temperature Logs March April 2024

Apr 20, 2024
169.22 MB
Publicly accessible
This dataset consists of Baker Hughes Pressure-Temperature gauge readings on fiber optics in Utah FORGE Well 16B(78)-32. This gauge is at a measured depth of 7,056.67 feet. The true vertical depth can be determined from the well survey data, which is linked below. The data consis...
Authors
McLennan, J. and Hughes, B. Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16b78-32well 16butah forgebaker pressure temperature logspressure temperaturetemperaturepressurewell 16b78-32 pressure temperature logswell 16b78-32 temperature logswell 16b78-32 pressure logsfiber opticsbaker hughes

EGS Collab: Hydraulic Fracturing Test Measurements on the 4100L of SURF

Aug 15, 2019
21.63 MB
Publicly accessible
This package includes data from two days of testing at the Sanford Underground Research Facility (SURF) on the 4100 level. The tests were performed in borehole TV4100 in the battery charging alcove south of the Yates shaft. TV4100 is a vertical borehole ~50 meters deep. A series o...
Authors
Ingraham, M. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsblack hillsboreholestressdatapressureflowinjectioninitial shut in pressureisipfractureraw datashift reports4100linjection testheat flowrhyoliteamphibolitegeophysics

Utah FORGE: Milford Deep Test Well 58-32 (MU-ESW1) Pressure and Temperature Logs

Nov 08, 2018
1.23 MB
Publicly accessible
This archive consists of a pdf graphic log and a LAS text file representing the results of the pressure and temperature logs measured on Nov. 8th, 2018 from the Utah FORGE deep test well 58-32 (MU-ESW1). The logs were taken by DI Drill Survey Services.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgepressuretemperaturewel 58-32pressure logtemperature logroosevelt hot springsutahwell mu-esw1pressure/temperature logmilfordbeaver countylogmu-esw1deeptestwell58-32well loglaswell dataresourcecharacterizationegs

Distributed Acoustic Sensing (DAS) for Periodic Hydraulic Tests: Laboratory Data

Feb 27, 2015
67.03 GB
Publicly accessible
These data were collected in the laboratory located at California State University Long Beach. They consist of DAS data collected from a fiber optic cable placed in a tank of water, subjected to oscillating head. These tests are described in the article linked below.
Authors
Coleman, T. California State University
geothermalenergydasdistributed acoustic sensingfiber opticsfluid pressure sensingfiber-opticacoustic sensing datacsu long beachlab dataoscillating pressurehydraulic testingperiodic

Utah FORGE: Shut-in Wellhead Pressure Data for Wells 16A(78)-32 and 16B(78)-32

Aug 25, 2025
1.22 MB
Publicly accessible
This dataset contains wellhead pressure measurements for Utah FORGE wells 16A(78)-32 and 16B(78)-32 during two distinct shut-in periods. The first spans from September 2024 to April 2025, covering the interval between the conclusion of a 28-day circulation test and the start of a ...
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge16a16bshut inshut-inwell head pressure16a78-3216b78-32egswell pressurepressure monitoringcirculation testworkover operationstime series datapsireservoir testingwell operationsraw data

Experimental Images and Videos of Foam Stability (Half-life)

Sep 15, 2021
227.45 GB
Publicly accessible
The experimental data obtained in this project is the thermal stability data of various foams measured using the setup established at Temple University during this study. The setup is installed with a portable digital camera which can take images and videos of foam evolution at a ...
Authors
Thakor, V. et al Temple University
enhanced geothermal systemfoam fracturingfoam stabilityhalf-lifefoammediavideosimageshalf lifetestfracturing fluidtest footagerecordingsegsenhanced thermal systemstemperaturepressure
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service