OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 151 - 175 of 541.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"stim and flow system"×
Data×

Fluid Rare Earth Element Analyses from Geothermal Wells Located on the Reykjanes Peninsula, Iceland and Middle Valley Seafloor Hydrothermal System on the Juan de Fuca Ridge.

May 01, 2015
692 kB
Publicly accessible
Results for fluid rare earth element analyses from four Reykjanes peninsula high-temperature geothermal fields. Data for fluids from hydrothermal vents located 2400 m below sea level from Middle Valley on the Juan de Fuca Ridge are also included. Data have been corrected for flash...
Authors
Fowler, A. University of California
geothermalreykjanessvartsengihellisheidinesjavellirmiddle valleyreehydrothermal fluidgeothermal fluidrare earth elementmineral recoveryaqueous chemistryaasg geothermal datausgin content modelngds content model

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data

Maui Gravity and Soil Gas Surveys

Apr 01, 2010
1.37 MB
Publicly accessible
Contains a ground-based gravity survey of South Maui and a series of soil CO2 flux and temperature surveys encompassing Maui and the Big Island. The gravity survey was collected from approximately 284 km2 and consisted of 400 gravity stations with 400 m spacing. Locations were de...
Authors
Akerley, J. Ormat Nevada Inc
geothermalgravitymauigeophysicsbouger anomalysoil fluxgeochemistrysoil gastemperaturehawaiibig island

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

Improved Microseismicity Detection During Newberry EGS Stimulations

Nov 01, 2013
214.5 kB
Publicly accessible
Effective enhanced geothermal systems (EGS) require optimal fracture networks for efficient heat transfer between hot rock and fluid. Microseismic mapping is a key tool used to infer the subsurface fracture geometry. Traditional earthquake detection and location techniques are oft...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsseismicitymicroseismicitystimulationfracturereservoirngds content modelusgin content modelinduced seismicitynewberrymicroearthquakemonitoringmeasurementdetectionhydrualic

Analysis of Geothermal Resources in Three Texas Counties

Oct 30, 2020
37.52 MB
Publicly accessible
This project updates the geothermal resources beneath our oil and gas fields, as part of the research for the Texas GEO project. This report "Analysis of Geothermal Resources in Three Texas Counties" (October 2020) improves on previous mapping of the Texas resources for the counti...
Authors
Richards, M. and Batir, J. Southern Methodist University Huffington Department of Earth Sciences
geothermalenergytexas geobottom hole temperatureradiogenic heat productionthermal conductivity10 kmjackson county txcrockett county txwebb county txoil and gas wellstexasjackson countycrockett countywebb countyoil and gaswell dataformation temperaturetemperaturestratigraphyformationlithologytemperature gradientheat flowradiogenicmapborehole

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Cornell University Borehole Observatory Pason Drilling Parameters

Jun 24, 2026
137.28 MB
In progress
This data set included drill rig drilling parameters from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 an...
Authors
Fulton, P. et al Cornell University
geothermalenergyegsdirect useappalachian basindrilling datacornell universitycubodeep direct useddudistrict heatingdeep welldrillingesh-1api 31109300030000

Maui Aeromagnetic Survey

Apr 17, 2010
90.3 MB
Publicly accessible
Map, image, and data files, and a summary report of a high-resolution aeromagnetic survey of southern Maui, Hawai'i completed by EDCON-PRJ, Inc. for Ormat Nevada Inc using an helicopter and a towed sensor array.
Authors
Akerley, J. Ormat Nevada Inc
geothermalhawaiimauiaeromagaeromagneticssurveymagnetometergeometricshaleakalavolcanototal magnetic intensityreduced to polehorizontal gradienttiltderivative

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Publicly accessible
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

University of Illinois Campus Deep Direct-Use Feasibility Study Porosity and Permeability of Rock Formations

Mar 30, 2018
93.1 kB
Publicly accessible
Porosity and permeability data from published and unpublished sources for the St. Peter and Mt. Simon Sandstones in the Illinois Basin.
Authors
Damico, J. et al University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoisillinois basinst. peter sandstoneporositypermeabilitymt. simon sandstoneoil and gas well

Literature Data on Foam Fracturing Fluid

Nov 08, 2021
103.25 kB
Publicly accessible
At the beginning of this project, the Temple team spent significant effort to collect data relevant to foam fracturing. More than 40 articles/reports were found in the open literature that reported the properties of aqueous foams under various testing conditions. The foam properti...
Authors
Thakor, V. et al Temple University
geothermalenergyenhanced geothermal systemsfoam fracturing fluidsfoamfoam fracturingdataliterature reviewdata collectionprocessed datareference

Passive Seismic Emission Tomography Results at San Emidio Nevada

Dec 01, 2016
66.54 MB
Publicly accessible
The utility of passive seismic emission tomography for mapping geothermal permeability has been tested at San Emidio in Nevada. The San Emidio study area overlaps a geothermal field in production since 1987 and another resource to the south of the production field. Passive seismic...
Authors
Warren, I. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalgeospatial dataexcelp-wave velocity modelpassive seismicp-waveprocessed dataseismicvelocityhydrothermalsan emidiogeophysicspsetcharacteriztion

Community Geothermal: Energy, Cost, and Carbon Modeling for District Design Ann Arbor, MI

Jan 01, 2024
410.48 MB
Publicly accessible
This data includes results on an analysis of existing and projected energy, cost, and carbon for the City of Ann Arbor District Geothermal Design and Deployment to Equitably Decarbonize Low Income Neighborhoods in Ann Arbor project. The scope of the project includes designing and ...
Authors
Lee, J. and McMillen, A. IMEG Corp
geothermalenergyenergy plusdesign buildermichigancommunity geothermaldistrict geothermalcommgeoann arborheating and coolingenergy loadenergy modelcostcarbonbenchmarkingprocessed dataload timeseriesmodelresstockeconomicenvironmentalassessmentenergy auditbuilding modelingdevelopment

Raw Pressure Data from Boise Hydrogeophysical Research Site (BHRS)

Jul 17, 2013
271.6 MB
Publicly accessible
Pressure data from a phreatic aquifer was collected in the summer of 2013 during Multi-frequency Oscillatory Hydraulic Tomography pumping tests. All tests were performed at the Boise Hydrogeophysical Research Site. The data will be inverted using a fast steady-periodic adjoint-bas...
Authors
Lim, D. University of Wisconsin
geothermaltomographyhydrologypressureboiseoscillatory flowaquifer characterizationwellsporotomopressure testwell testraw databhrshydrogeophysicalpressure datawellreservoir characterizationidaho

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing

Utah FORGE: Laboratory Experiments Examining the Effect of Thermal and Mechanical Processes on Hydraulic Transmissivity Evolution

Apr 03, 2023
858.13 kB
Publicly accessible
Using laboratory slide-hold-slide experiments, at temperatures from 22 to 200 degrees C, to examine effects of fracture reactivation and quasi-static loading on the evolution of fluid transport properties of simulated fractures in Westerly granite. At all temperatures, the in-plan...
Authors
Lockner, D. et al United States Geological Survey
geothermalenergyutah forgehydraulic transmissivityfluid-rock interactionsshear fracturessealinggranite

Utah FORGE: Laboratory Fault Reactivation and Permeability Evolution During Fluid Injection

Sep 15, 2025
182.35 GB
Publicly accessible
This dataset contains results from controlled shear reactivation experiments performed on cylindrical Westerly and granitoid granite samples with a single inclined fracture. Laboratory faults were pre-loaded near failure and reactivated by fluid injection to examine relationships ...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergyinduced seismicityutah forgewesterly granitegranitoidpermeabilityshear stimulationegsfault reactivationfluid injectionpermeability evolutionseismicityacoustic emissionssingle inclined fractureshear stresspore pressuretriaxial testingmechanical datageomechanicsraw dataprocessed dataacoustic data

Community Geothermal: Soil Conductivity, Borehole Design, Energy Models, and Load Data for a Residential System Development Hinesburg, VT

Aug 30, 2024
743.47 MB
Publicly accessible
This dataset contains materials from the Coalition for Community-Supported Affordable Geothermal Energy Systems (C2SAGES) project, which evaluated the techno-economic feasibility of a community geothermal system for a residential development in Hinesburg, VT. The dataset includes ...
Authors
Jogineedi, R. et al GTI Energy
geothermalenergycommunity geothermalgeothermal sizingborehole testinggeothermal heat pumpworkforce developmentbuilding energy modelingground heat exchangergeothermal network designcommunity engagementcommgeohinesburgvermontmodelicaenergyplusonepipepythonmodelingthermal conductivity testreportenergy modelborehole designhourly energy loadssizinggeothermal loop sizingsystem designdevelopment

Hawthorne Nevada Deep Direct-Use Feasibility Study Navy Geothermal Program Office General Data

Mar 29, 2018
693.88 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorne

SSGF Trace Element Concentrations

Jan 08, 2026
706.57 kB
Awaiting release
Presented are trace element concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is actively being studied as a source of geothermal brine for lithium extraction. ...
Authors
Kovalick, A. et al University of California Riverside
geothermaltrace elementssalton sea geothermal fieldrocksmineralhydrothermallithium valleygeothermal brineraw dataimperial countyssgfimperial valleyrare earth elementsreecritical mineralsmnznconibrine-rock reactionrock samplesbrine samplesrhyolitic domesdurmid hillsschmitt and hulenca 2-14wellschemistryfluid chemistrygeochemistrysalton sealithium extraction

EGS Collab Experiment 2: Distributed Fiber Optic Acoustic Data (DAS)

May 28, 2024
212.2 TB
Publicly accessible
Distributed fiber optic sensing was an important part of the monitoring system for EGS Collab Experiment #2. A single loop of custom fiber package was grouted into the four monitoring boreholes that bracketed the experiment volume. This fiber package contained two multi-mode fiber...
Authors
Rodriguez Tribaldos, V. and Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 2distributed acoustic sensingdassilixaidasterra15trebleoptasenseodh3hdf5tdmsraw datastrain ratemulti-mode fibersingle-mode fibergeophysics

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes
<< Previous234567891011Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service