OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 555.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"point data"×
Data×

EGS Collab Experiment 2: Laser Scanned 4100 L Drift Map

Dec 19, 2019
1.26 GB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergylaser scanned drift mapsurfegs collabhydraulic shearingsanford underground research facilityhydraulic fracturingegslaser scanneddrift mapyates shaftbattery charging stationlaser surveytestbed 2experiment 2autocadleapfrogpoint cloudmapremote sensing

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Recovery Act: Microhole Tubing Bending Report

Jan 01, 2012
Size unavailable
Publicly accessible
A downhole tubing bending study was made and is reported herein. This study developed a model to predict the shape of the pipe at downhole conditions and determines if the various pipe string sizes can reach a specified landing depth. The wellbore trajectory is described by this s...
Authors
Ruan, C. Impact Technologies LLC
geothermaltubingdrill pipedrillingmicroholemicroboretubing bendingwell constructionmodelabrasive slurryjet technologyegs

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

WHOLESCALE: Coordinates of wells at San Emidio, Nevada

Sep 25, 2023
2.13 kB
Publicly accessible
This dataset includes position coordinates and elevation information for wells at the WHOLESCALE San Emidio project location. Well positions in the attached file are characterized by UTM coordinates (Easting, Northing) in meters, and WHOLESCALE coordinates (Easting, Northing) rel...
Authors
Cardiff, M. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalcoordinateswell locationwell informationsan emidiogeospatialstress evolutionnevada

Financial Summary, Nanofiltration Data, and Lithium Uptake Data

Dec 05, 2016
177.89 kB
Publicly accessible
Integrated testing of nanofiltration and lithium uptake subsystems using synthetic geothermal brine. Also includes a financial summary (Pro Forma) of the proposed 'Geothermal Thermoelectric Generation (G-TEG) with Integrated Temperature Driven Membrane Distillation and Novel Manga...
Authors
Renew, J. Southern Research Institute
geothermalnanofiltrationlithium uptakenano hmobrinerejection efficiencychemistryfinancialpro formageorgiasynthetic geothermal brinesouthern research institutethermoelectricg-teglithium extractionnpvnet present valueeconomicspricediscount ratecost per metric toncost summaryrevenue

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

University of Illinois Campus Deep Direct-Use Feasibility Study Long-Term Meteorological Data

Mar 30, 2018
74.24 MB
Publicly accessible
This submission includes meteorological data recorded by National Weather Service at University of Illinois Willard Airport, Savoy IL for period 1972 to 2018. This data is for use in parameterizing the demand and life-cycle assessments associated with the project, and provides inf...
Authors
Lin, Y. University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoismeteorologicalwillard airportnational weather serviceweather

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

High-Pressure and High-Temperature (HPHT) Lost Circulation Material (LCM) Testing

Nov 30, 2021
7.92 MB
Publicly accessible
High-pressure and high-temperature (HPHT) lost circulation material (LCM) rheology test results, LCM particle size distributions (PSD) analysis, and HPHT LCM fluid loss test results. Three academic papers / reports derived from this research are also presented.
Authors
Salehi, S. and Vivas, C. University of Oklahoma
geothermalenergylost circulation materialshpht filtrationfracture sealingparticle size distributionrheologydrilling fluid additivesgelationthermal degradationhigh pressure high temperaturepsdtemperaturemodeldrillingwellboreexperimenttechnologyprocessed datalcm

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

EGS Collab Experiment 1: Second Set Tracer Test Results

Dec 19, 2019
4.94 MB
Publicly accessible
The EGS Collab project is developing ~10-20 m-scale field sites where fracture stimulation and flow models can be validated against controlled, small-scale, in-situ experiments. The first multi-well experimental site was established at the 4850 level in the Homestake Mine in Lead,...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsurftracer testssigma-vc-dotsrhodamine-bfluoresceinbreakthrough curvechloridetracer datahydraulicfracturingsimulationtracerexperimentalegssanford underground research facilityinjectionsodium chloridelithium bromidecesium iodinetestbed 1stimulation

Utah FORGE: Slide-Hold-Slide Experiments on Gneiss at Increased Temperature

Jul 25, 2023
4.1 GB
Publicly accessible
Included are data from triaxial, single-inclined-fracture friction experiments. The experiments were performed with slide-hold-slide protocol on Utah FORGE gneiss at increased temperature. With a ~10 MPa normal stress, temperatures vary between experiments from room temperature u...
Authors
Eijsink, A. and Elsworth, D. Pennsylvania State University
geothermalenergyfrictionsingle inclined fractureslide-hold-slideacoustic dataacoustic emissionpassive acousticgeophysicsfracturereactivationgneissutah forgeegsfriction dataactive acousticvelocity data

Structural Inventory of Great Basin Geothermal Systems and Definition of Favorable Structural Settings

Dec 31, 2013
244.5 kB
Publicly accessible
Structural controls of 426 geothermal systems in the Great Basin region including western Nevada, central Nevada, northwestern Nevada, northeastern Nevada, east-central Nevada, eastern California, southern Oregon, and western Utah were analyzed with literature research, air photos...
Authors
Faulds, J. University of Nevada
geothermalquaternary faultsstructural controlsblind geothermal systemstemperaturegeothermometryfield visitswestern nevadacentral nevadanorthwestern nevadanortheastern nevadaeast-central nevadaeastern californiasouthern oregonwestern utahutahnevadaoregoncaliforniabaltazor hot springblue mountainbog hot springdyke hot springshoward hot springmacfarlane hot springmcgee mountainpinto hot springsbeowawecrescent valleyhot springs pointdann ranchhand-me-down hot springsgolcondapumpernickel valleytipton hot springsash springschimney hot springduckwaterhiko hot springiverson springmoon river hot springmoorman springrailroad valleywilliams hot springwalleys hot springantelope valleyfales hot springsbuckeye hot springstravertine hot springsteels marshrhodes marshcolumbus marshalum-silver peakfish lake valleygabbs valleywild roserawhide-wedell hot springsalkali hot springsbaileys/hicks/burrell hot springsalvord hot springbaileys hot springburrell hot springhicks hot springantelope hot springhart mountainborax lakecrump geysermickey hot springnewcastleveyo hot springdixie hot springthermorooseveltcove fortred hill hot springjoseph hot springhatton hot springabraham-baker hot springsgreat basinhot creek butte

Brady's Geothermal Field March 2016 Vibroseis SEG-Y Files and UTM Locations

Mar 31, 2016
982.28 GB
Publicly accessible
PoroTomo March 2016 Updated vibroseis source locations with UTM locations. Supersedes gdr.openei.org/submissions/824. Updated vibroseis source location data for Stages 1-4, PoroTomo March 2016. This revision includes source point locations in UTM format (meters) for all four Stage...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisegsactive seismicsurveymetadatasweep datasource locationsutmactive sourcetruckgeophysicsgeophysicalsegyseismic datadasdasv

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Analysis of Existing Data from a Distributed Acoustic Sensing Experiment at Garner Valley, California

Sep 01, 2013
1.16 MB
Publicly accessible
In September 2013, an experiment using Distributed Acoustic Sensing (DAS) was conducted at Garner Valley, a test site of the University of California Santa Barbara (Lancelle et al., 2014). This submission includes noise cross-correlation functions (NCF) . Each file includes a NCF ...
Authors
Zeng, X. University of Wisconsin
porotomoegsseismic tomographyambient noisencfdasdistributed acoustic sensinggarner valleycalifornianoise cross-correlation funcitonfiber-optics

Cape EGS: Frisco Pad Flow Test Microseismic DAS Data

Feb 11, 2026
21.05 GB
Awaiting release
This dataset contains microseismic data acquired during the Frisco pad flow test project led by Fervo Energy, conducted between August and September 2025 near the Utah FORGE geothermal site. The data were recorded using a Distributed Acoustic Sensing (DAS) fiber installed in well ...
Authors
Kanu, O. Fervo Energy
geothermalenergycape egsegsfervo energyutah forgedistributed acoustic sensingdasfiber-optic sensingmicroseismic monitoringinduced seismicitywell 16bfrisco padflow teststrain-ratehdf5h5silixa idasdownhole fiber-optic sensinggeophysicsraw data

Raw Neutron Scattering Data for Strain Measurement of Hydraulically Loaded Granite and Marble Samples in Triaxial Stress State

May 23, 2014
22.11 MB
Publicly accessible
This entry contains raw data files from experiments performed on the Vulcan beamline at the Spallation Neutron Source at Oak Ridge National Laboratory using a pressure cell. Cylindrical granite and marble samples were subjected to confining pressures of either 0 psi or approximate...
Authors
Polsky, Y. Oak Ridge National Laboratory
geothermalneutronstrainhydraulic fracturingegsdiffractiongranitemarbletriaxialhydraulic fracturestressneutron scatteringvulcan beamline

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service