OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 147.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"seismic imaging"×
Document×

Utah FORGE: 2022 Seismic Workshop Report

Dec 19, 2022
505.62 kB
Publicly accessible
Utah FORGE held a two-day seismic workshop on the University of Utah campus in Salt Lake City, Utah on September 26 and 27, 2022 to share what was learned from the seismic monitoring during the 2022 stimulation. This is a report documenting this workshop. The meeting was structure...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeseismicseismicityseismic monitoring protocolseismic instrumentationseismic traffic light systemsseismic workshop2022 seismic workshopegs seismicityforgeegsworkshopreportstimulationseismic networkpressure monitoringresource development

Utah FORGE: 2023 Induced Seismicity Mitigation Plan

Aug 09, 2023
7.97 MB
Publicly accessible
This is the updated Utah FORGE Phase 3B induced seismicity mitigation plan (ISMP) covering the general Utah FORGE area. This new version incorporates newly collected seismic data, including data collected during the 2022 stimulation and a probabilistic seismic hazard assessment (...
Authors
Pankow, K. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic mitigation planseismic mitigationseismicityseismicseismic hazardsearthquakesinduced seismicitygeophysicsfaultsoutreachriskhazardegsseismic monitoringseismic hazard assesment

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

Utah FORGE: Orientation of Borehole and Surface Seismic Stations

Jun 21, 2023
7.82 MB
Publicly accessible
The University of Utah Seismograph Stations (UUSS) are responsible for the seismic monitoring of the experiments and have installed a series of permanent surface and borehole seismic instruments around the Utah FORGE project site. This report discusses the methods used for proper ...
Authors
Bradshaw, P. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic stationsseismic monitoringseismicseismic station reportseismic station orientationseismic station alignmentseismicity monitoring

Utah FORGE: Development of a Reservoir Seismic Velocity Model and Seismic Resolution Study

Apr 30, 2022
15.3 MB
Publicly accessible
This is data from and a final report on the development of a 3D velocity model for the larger FORGE area and on the seismic resolution in the stimulated fracture volume at the bottom of well 16A-32. The velocity model was developed using RMS velocities of the seismic reflection su...
Authors
Vasco, D. and Chan, C. Array Information Technology
geothermalenergyseismic velocity modelseismic resolution3d p-wave3d s-waveseismicraw dataprocessed datawell 16a-32utah forge

Utah FORGE: Seismic Risk Trafic Light System Version 2

Jan 24, 2025
574.05 kB
Publicly accessible
The report outlines the updated Traffic Light System (TLS) for the Utah FORGE project, which aims to mitigate seismic risks associated with Enhanced Geothermal Systems (EGS) operations. It integrates lessons from past operations, including stimulation and circulation experiments a...
Authors
Pankow, K. et al University of Utah Seismograph Stations
geothermalenergyseismicseismic hazardstlstrafic light systemutah forgeseismic hazard mitigationwell stimulationegstraffic light systemseismic risk mitigationstimulationcirculationcape stationseismic thresholdsreal-time monitoringqseekreservoir dynamicsseismic eventsmagnitude thresholdsprotocols

Utah FORGE 3-2535: Preliminary Report on Development of a Reservoir Seismic Velocity Model

Jan 30, 2023
5.8 MB
Publicly accessible
This report describes the development of a preliminary 3D seismic velocity model at the Utah FORGE site and first results from estimating seismic resolution in the generated fracture volume during Stage 3 of the April 2022 stimulation. A preliminary 3D velocity model for the larg...
Authors
Gritto, R. Array Information Technology
geothermalenergy3d seismic velocity modelseismic resolutionseismicgeophysicsreservoirmodelvelocityforgeutah forgeegscharacterizationreportpreliminarymilfordphasenetneural networkingmachine learningdeep learning

Utah FORGE: Borehole PSS Tools Status Report

Dec 29, 2022
6.52 MB
Publicly accessible
This report summarizes the data quality from the Utah FORGE borehole passive seismic sensors (PSS) tools at well sites 58-32 and 78B-32. Two level Avalon tools were installed on 09-28-2022 and 09-29-2022 by representatives from Avalon, Schlumberger, University of Utah, and Instrum...
Authors
Stachnik, J. Instrumental Software Technologies, Inc.
geothermalenergyutah forgeseismic sensorsseismicseismicityborehole seismic sensorsborehole passive seismic sensorspsspassive seismic sensorsseismic sensing tools

Seismic Survey 2016 Metadata at San Emidio, Nevada

Dec 05, 2016
54.86 MB
Publicly accessible
1301 Vertical Component seismic instruments were deployed at San Emidio Geothermal field in Nevada in December 2016. The first record starts at 2016-12-05T02:00:00.000000Z (UTC) and the last record ends at 2016-12-11T14:00:59.998000Z (UTC). Data are stored in individual files in o...
Authors
Lord, N. et al University of Wisconsin
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadareporttechnical specificationintrumentationspecsspecspecifications

EGS Collab Experiment 2: Co-Injection Sewer Camera Survey Videos

May 20, 2025
38.69 GB
Curated
On April 21, 2022, sewer camera surveys were conducted in boreholes TN and TL as part of Experiment 2 of the EGS Collab project. These surveys were performed during fluid injection into three zones in borehole TC to identify the depths of active fracture intersections. The goal wa...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergysewer camegs collabfractureflowegsfracture characterizationsewer camera surveyborehole videovideosdownhole imaginginjectionfracture inflowtntltcexperiment 2injection zones

Brady Geothermal 1D Seismic Velocity Model

Feb 17, 2015
90.17 kB
Publicly accessible
This submission contains an ASCII text file of seismic velocities derived from ambient noise cross-correlation used to create a model of seismic velocity as a 1-D function of depth in addition to a quarterly report describing the creation and use of the model. Model uses 28 Green'...
Authors
Matzel, E. Lawrence Livermore National Laboratory
geothermalseismic velocity modelinsarambient noisebrady geothermal seismic modelseismicseismic velocity1d

Utah FORGE: FSB4, FSB5, & FSB6 Shallow Seismic Well Locations

Mar 04, 2022
433 kB
Publicly accessible
This is a PDF file generated by Woolsey Land Surveying, P.C containing the surveyed locations, as located, in Latitude and Longitude degrees, of the Utah FORGE FSB4, FSB5, & FSB6 shallow seismic well locations.
Authors
Woolsey, S. and Larson, G. Woolsey Land Surveying
geothermalenergyutah forgeshallow seismic wellsseismic well locationsfsb4fsb5fsb6forgewellseismicityseismicgeophysicswell datadatacoordinatessurveyutah

Fallon FORGE: Seismic Reflection Profiles

Jan 01, 2015
14.3 MB
Publicly accessible
Fourteen seismic reflection profiles and their interpretations for the southern Carson Sink within and proximal to the proposed Fallon FORGE site. Five profiles were provided by the Navy Geothermal Program Office and reprocessed by Optim Inc. Nine proflies were acquired from the S...
Authors
Blankenship, D. Sandia National Laboratories
geothermalseismic profilescarson sinkfallonnevadaforgeseismicreflectiongeophysicstracesfaultdepth convertedinterpretedcontactsnvinterprettedinterpretationsei

Hawthorne Nevada Deep Direct-Use Feasibility Study 3D Seismic

Mar 29, 2018
467.07 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. et al Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduopendtectpstmprestack time migrationfault interpretationhawthornegeospatial data

Snake River Plain Geothermal Play Fairway Analysis Project Active Source Seismic Data

Sep 30, 2018
5.99 GB
Publicly accessible
This archive contains seismic shot field records for 10 profiles located in Camas Prairie, Idaho. The eight numbered .sgy files were acquired using a seismic land streamer system with an accelerated weight drop source and 72 geophones. These 10-Hz geophones were mounted on base pl...
Authors
Liberty, L. and Shervais, J. Boise State University
geothermalenergypfaplay fairway analysisidahosrpsnake river plainseismicactive sourcedatageophysicsmapsurveygeophysicalcamasprairiesgygeologytopographyaerialgeologictopographicfairfield

Three-Component Long Offset Surface Seismic Survey Data Used to Find Large Aperture Fractures in Geothermal Resources San Emidio Geothermal Resource Area

Sep 15, 2010
794.98 MB
Publicly accessible
P and S-wave datasets and associated report studying the ability to use three-component long offset surface seismic surveys to find large aperture fractures in geothermal resources at the San Emidio geothermal resource area in Washoe County, Nevada.
Authors
Warren, I. U.S. Geothermal Inc.
geothermalsan emidiofracture apertureseismic surveyp-wave datas-wave datareportfracture detectionwashoe countynevadadatas-wavep-waveseismic data processingnvvibroseisactive sourcesweep

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Curated
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Walker Ranch 3D Seismic Images

Mar 01, 2016
836.05 kB
Publicly accessible
Amplitude images (both vertical and depth slices) extracted from 3D seismic reflection survey over area of Walker Ranch area (adjacent to Raft River). Crossline spacing of 660 feet and inline of 165 feet using a Vibroseis source. Processing included depth migration. Micro-earthqua...
Authors
J., R. Lawrence Livermore National Laboratory
geothermal3d seismic reflectionwalker ranchraft river3d seismicdepth slicenarrowsmeqmicroseismicitygeophysicsegsnarrows zoneactive source

Final Report: Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Nov 18, 2015
31.13 MB
Publicly accessible
This is a final report summarizing a two-year (2014-16) DOE funded Geothermal Play Fairway Analysis of the Low-Temperature resources of the Appalachian Basin of New York, Pennsylvania and West Virginia. Collaborators included Cornell University, Southern Methodist University, and ...
Authors
E. Jordan, T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacitygpfa-abgeothermal play fairway analysisthermal analysisresource assessmentheat flowthermal conductivitygeothermsheat utilizationsurface leveled cost of heatlcohslcohdemandgeophirescombined risk segment mapsrisk analysisinduced seismicityfaultspotential fieldswaveletsbht correctionslow temperature

Fallon FORGE: Seismic Reflection Profiles

Feb 01, 2018
33.35 MB
Publicly accessible
Newly reprocessed Naval Air Station Fallon (1994) seismic lines: pre-stack depth migrations, with interpretations to support the Fallon FORGE (Phase 2B) 3D Geologic model. Data along seven profiles (>100 km of total profile length) through and adjacent to the Fallon site were re-...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallonnevadaseismicreflectionvetted-nodepth migrationgeophysicsprocessed dataprestackinterpretedsite mapsurvey mapreprocessed datareprocesseddata

Utah FORGE: Preliminary Monitoring, Analyses, and Impact Assessment

Feb 09, 2017
9.97 MB
Publicly accessible
Preliminary monitoring and analyses for the Utah FORGE Milford Site. Includes a report detailing the seismic monitoring goals and results, a detailed techno-economic infrastructure assessment with an analysis, a budget, schedules, and cost summaries, and a summary of environmental...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalutahforgeutah forgeseismicseismic monitoringroosevelt hot springsmilfordreporttechno-economic infrastructureschedulesutah geothermalbudgettechno-economicnepaenvironmental impactsenvironmentassessmentevironmentalgeophysicseconomictechnicalmonitoringinfrastructureschedulecosteaseismicity

WHOLESCALE: Seismic Survey Data from San Emidio Nevada 2021

Apr 06, 2021
1.67 TB
Publicly accessible
This dataset includes raw and processed seismic data from the 2021 seismic survey at the San Emidio geothermal field in Nevada. In April and May 2021, 37 tri-axial short period seismographs were deployed in a 1.8km diameter cluster centered on 40.367278 N, 119.409019 W. The first...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsacraw dataprocessed datageophysicssiesmic datasmartsolodatacubeseismographdata lakesan emdidionevadapumpingtri-axialdld

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service