Search GDR Data

Showing results 26 - 33 of 33.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"EGS"×
Image×

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Simulations of Brady's-Type Fault Undergoing CO2 Push-Pull: Pressure-Transient and Sensitivity Analysis

Mar 09, 2018
9.74 MB
Publicly accessible
Input and output files used for fault characterization through numerical simulation using iTOUGH2. The synthetic data for the push period are generated by running a forward simulation (input parameters are provided in iTOUGH2 Brady GF6 Input Parameters.txt [InvExt6i.txt]). In gene...
Authors
Jung, Y. and Doughty, C. Lawrence Berkeley National Laboratory
geothermalenergyegsco2carbon dioxidepush-pullpressure-transient testingitough2sensitivity analysisinverse modelingparameter estimationinconpesttough2fault modelinggf6bradyfaultingfaultfracturecharacterizationstimulation

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Utah FORGE: Fluid Injection Induced Shearing Experiments on Fractured Granitoid at Elevated Temperatures

Aug 12, 2024
80.21 MB
Publicly accessible
This repository contains experimental data from a series of fluid injection-induced shearing tests conducted on Utah FORGE granitoid. The experiments were performed using an aluminum triaxial pressure vessel (TEMCO) apparatus at Pennsylvania State University. The primary aim was t...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergytemperatureexperimentpre-stressseismicityutah forgeegsgranitoidtemcotriaxial pressure vesselfault seismicitypre-stress ratioshearpore pressure60-gritinclined fracture

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata
<< Previous12