OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 24 of 24.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Tracer Test"×
Image×

Utah FORGE: Optimization of a Plug-and-Perf Stimulation (Fervo Energy)

Feb 08, 2023
6.91 MB
Publicly accessible
Information around the plug-and-perf treatment design at Utah FORGE by Fervo Energy. Objective and Purpose: Develop a multistage hydraulic stimulation approach designed specifically to target the top three factors that control the technical and commercial viability of an EGS sys...
Authors
Norbeck, J. et al Fervo Energy
geothermalenergyutah forgeplug-and-perf stimulationwell stimulationfervo energyplug-and-perfplug and perffervotechnicalassessmentfeasibilityhydraulicstimulationinjection testprocessed datablue mountainnevadaegswell 73-22well 34a-22well 34-22near-field egshorizontal drillingproppantheat in placestate of stressfiber optic sensing

Images of Fracture Sustainability Test on Stripa Granite

May 11, 2014
12.2 MB
Publicly accessible
Images of the Stripa Granite core before and after the fracture sustainability test. Photos of fracture faces of Stripa Granite core.
Authors
Kneafsey, T. Lawrence Berkeley National Laboratory
geothermalfracturesustainabilitystripa granitefracture face imagescore imagesgranite fracturesgranite corelbnlgranitecoreimages

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

West Flank Coso, CA FORGE Test Area

Nov 15, 2015
773.24 kB
Publicly accessible
A map with the Coso West Flank FORGE test area outlined, along with regional seismicity, the aeromagnetic data set and the area currently being utilized for the creation of the 3D model.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankforgegeographygeophysicscaliforniacososeismicityaeromagnetic

DCIF (Directional Cooling-Induced Fracturing) Westerly Granite AE Borehole Damage Effect Test (Task 3-0)

Jan 27, 2022
162.51 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on three rectangular Westerly granite blocks (width=depth=4.0", height=2.0") which were preheated to 200, 400, and 600 degree C to induce damage (microcracks) with varying degrees. Liquid nitrogen was poured...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalenergydirectional cooling induced fracturingdcifdirectional cooling-induced fracturingdamage effect testfracturemicrocrackthermal stressacoustic emissionaccousticsthermal fracturefailure testraw dataprocessed datastressbiaxial stresswesterly graniteborehole damage effecttestwesterlygranite

EGS Collab Experiment 2: Preliminary Test Wells Locations and Orientations

Dec 19, 2019
233.95 kB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergysurfegs collabgyro datahydraulic fracturinghydraulic shearingsanford underground research facilitywell locationswellstestbed 2lidarremote sensingegsexperiment 2well locationwell orientationsigma-vtest wellswell dataleapfroghomestake mineboreholegyrocollar location

Utah FORGE: Fluid Injection Induced Shearing Experiments on Fractured Granitoid at Elevated Temperatures

Aug 12, 2024
80.21 MB
Publicly accessible
This repository contains experimental data from a series of fluid injection-induced shearing tests conducted on Utah FORGE granitoid. The experiments were performed using an aluminum triaxial pressure vessel (TEMCO) apparatus at Pennsylvania State University. The primary aim was t...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergytemperatureexperimentpre-stressseismicityutah forgeegsgranitoidtemcotriaxial pressure vesselfault seismicitypre-stress ratioshearpore pressure60-gritinclined fracture

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Community Geothermal: Soil Conductivity, Borehole Design, Energy Models, and Load Data for a Residential System Development Hinesburg, VT

Aug 30, 2024
743.47 MB
Publicly accessible
This dataset contains materials from the Coalition for Community-Supported Affordable Geothermal Energy Systems (C2SAGES) project, which evaluated the techno-economic feasibility of a community geothermal system for a residential development in Hinesburg, VT. The dataset includes ...
Authors
Jogineedi, R. et al GTI Energy
geothermalenergycommunity geothermalgeothermal sizingborehole testinggeothermal heat pumpworkforce developmentbuilding energy modelingground heat exchangergeothermal network designcommunity engagementcommgeohinesburgvermontmodelicaenergyplusonepipepythonmodelingthermal conductivity testreportenergy modelborehole designhourly energy loadssizinggeothermal loop sizingsystem designdevelopment

Reservoir Stimulation Optimization with Operational Monitoring for Creation of EGS

Sep 25, 2013
65.42 MB
Publicly accessible
EGS field projects have not sustained production at rates greater than half of what is needed for economic viability. The primary limitation that makes commercial EGS infeasible is our current inability to cost-effectively create high-permeability reservoirs from impermeable, igne...
Authors
A., C. Pacific Northwest National Laboratory
geothermalfracturing fluidmonitoringxmtnmracousticrheologypermeabilityegsigneous rock

Utah FORGE 3-2417: Meteorological Data During 2023 Completion/Circulation

Jun 10, 2024
2.4 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the completion/cementing of well 16B(78)-32 and the initial 2023 circulation test, largely occurring in June/July/August of 2023. This information may p...
Authors
Ajo-Franklin, J. Rice University
geothermalenergyutahutah forgeegsenhanced geothermalmeteorological datameteorologywell 78-16circulationcompletiontemperaturewindhumidityprecipitationtime seriesraw datacalibrationinstrument calibration78-16

EGS Collab Experiment 1: Temperature profile

Apr 01, 2019
18.7 MB
Publicly accessible
This submission includes an input file, plot file, Fortran conversion file, and 3D data file from the simulation of the temperature profile within the Test Bed #1 of the EGS Collab project. The simulation was executed with PNNL's STOMP-GT simulator, which reads the input file, and...
Authors
White, M. Pacific Northwest National Laboratory
geothermalenergysurfegs collabnumerical simulationstomp-gtdataegstemperaturedistribution3dwest access driftfortrancodesanford underground research facility

DCIF Westerly Granite AE Stress Effect Test (Task 3-1)

Jul 08, 2021
216.62 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on rectangular Westerly granite blocks (width=depth=4.0", height=2.0"). Liquid nitrogen was poured in a small, 1"-diameter copper cup attached to the top of the sample, and the resulting acoustic emissions (A...
Authors
Nakagawa, S. and Trzeciak, M. Lawrence Berkeley National Laboratory
geothermalenergythermal fracturingstress measurementfracturingprocessed datageophysicsstress testinggranitewesterly granitestressmicrofracturefracturedatatemperatureacoustic emissionacoustic emission locationacoustic emission rate

Directional Cooling-Induced Fracturing Westerly Granite Test Results

Dec 18, 2020
72.48 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on a short, cylindrical sample of Westerly granite (diameter = 4 inches, height ~ 2 inches). Liquid nitrogen was poured in a copper cup attached to the top of the sample, and the resulting acoustic emissions ...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalthermal crackingacoustic emissionstemperature changeslaboratory experimentwesterly granitegranitemoment tensorfractureseismicgeophysicsliquid nitrogenthermaltemperaturestimulationdirectional coolinginduced fracturingdirectional cooling-induced fracturingwellborestressvelocitytomographymicrocracking

EGS Collab Experiment 1: Well Locations and Orientations.

Sep 05, 2018
657.91 kB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsigma-vsurfwell locationegsstimulationhydraulicfracturingtestbed 1west access driftsanford underground research facilityboreholesgeophysical monitoringreflex gyroorientationslaser/lidermagnetic orientation survey

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Publicly accessible
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

PoroTomo Natural Laboratory Horizontal and Vertical Distributed Acoustic Sensing Data

Mar 29, 2016
342.13 TB
Publicly accessible
This dataset includes links to the PoroTomo DAS data in both SEG-Y and hdf5 (via h5py and HSDS with h5pyd) formats with tutorial notebooks for use. Data are hosted on Amazon Web Services (AWS) Simple Storage Service (S3) through the Open Energy Data Initiative (OEDI). Also include...
Authors
Feigl, K. et al University of Wisconsin
geothermalporotomodasfiber opticsurface sensorsseismic arraydistributed acoustic sensingporoeleastic tomographybradys geothermal fieldgeosciencedistributed sensingdownholetrenchedseismicityhydrothermalgeophysicsoediraw datajupyter notebookpythonhdf5hsdsh5pyh5pyd

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Project HOTSPOT: Kimama Well Core and Drill Site Photos

Jan 16, 2011
106.28 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainkimamaphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service