OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 70.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"geochemistry data"×
Image×

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

SSGF Trace Element Concentrations

Jan 08, 2026
706.57 kB
Awaiting release
Presented are trace element concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is actively being studied as a source of geothermal brine for lithium extraction. ...
Authors
Kovalick, A. et al University of California Riverside
geothermaltrace elementssalton sea geothermal fieldrocksmineralhydrothermallithium valleygeothermal brineraw dataimperial countyssgfimperial valleyrare earth elementsreecritical mineralsmnznconibrine-rock reactionrock samplesbrine samplesrhyolitic domesdurmid hillsschmitt and hulenca 2-14wellschemistryfluid chemistrygeochemistrysalton sealithium extraction

SSGF Mineral Major Elements and Lithium Concentration

May 01, 2023
1.38 MB
Publicly accessible
Presented are major element and lithium concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is now being studied as a source of geothermal brine for lithium extr...
Authors
Humphreys, J. et al Lawrence Berkeley National Laboratory
geothermallithiummineralrockssalton sea geothermal fieldbrinelithium isotopteschloritegeologygeochemistryhydrothermalisotope quantificationextractionsalton sealithium valleygeothermal brineimperial countyraw data

Project HOTSPOT: Mountain Home Well Borehole Geophysics Database

Nov 11, 2012
209.37 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainproject hotspotidahoyellowstone hotspotborehole geophysicsmountain homegeophysicsborehole logdowhnhole geophysicstemperaturepressuregamma raymagnetic susceptibilitygeochemistrythoriumuraniumpotassiumneutronresistivityimage logsrpboreholewell data

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Kilauea Magnetotelluric Dataset

Jun 16, 2022
1.21 MB
Publicly accessible
In 2002 and 2003 a collaborative effort was undertaken between Lawrence Berkeley National Laboratory, Sandia National Laboratories, the USGS Menlo Park, the USGS Hawaiian Volcano Observatory, and Electromagnetic Instruments Inc. to study the Kilauea volcano in Hawaii using the mag...
Authors
Hoversten, G. and Gasperikova, E. Lawrence Berkeley National Laboratory
geothermalenergymtkilaueamagnetotelluricimpedance tensorsstationsremote sensingprocessed dataeast rift zoneerzhawaiivolcanoresistancelavamagmamagma reservoirsimpedanceelectrical contact resistance

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

PoroTomo Natural Laboratory Horizontal and Vertical Distributed Acoustic Sensing Data

Mar 29, 2016
342.13 TB
Publicly accessible
This dataset includes links to the PoroTomo DAS data in both SEG-Y and hdf5 (via h5py and HSDS with h5pyd) formats with tutorial notebooks for use. Data are hosted on Amazon Web Services (AWS) Simple Storage Service (S3) through the Open Energy Data Initiative (OEDI). Also include...
Authors
Feigl, K. et al University of Wisconsin
geothermalporotomodasfiber opticsurface sensorsseismic arraydistributed acoustic sensingporoeleastic tomographybradys geothermal fieldgeosciencedistributed sensingdownholetrenchedseismicityhydrothermalgeophysicsoediraw datajupyter notebookpythonhdf5hsdsh5pyh5pyd

Utah FORGE 3-2417: Meteorological Data During 2023 Completion/Circulation

Jun 10, 2024
2.4 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the completion/cementing of well 16B(78)-32 and the initial 2023 circulation test, largely occurring in June/July/August of 2023. This information may p...
Authors
Ajo-Franklin, J. Rice University
geothermalenergyutahutah forgeegsenhanced geothermalmeteorological datameteorologywell 78-16circulationcompletiontemperaturewindhumidityprecipitationtime seriesraw datacalibrationinstrument calibration78-16

EGS Collab Experiment 1: Well Locations and Orientations.

Sep 05, 2018
657.91 kB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsigma-vsurfwell locationegsstimulationhydraulicfracturingtestbed 1west access driftsanford underground research facilityboreholesgeophysical monitoringreflex gyroorientationslaser/lidermagnetic orientation survey

Utah FORGE: Fluid Injection Induced Shearing Experiments on Fractured Granitoid at Elevated Temperatures

Aug 12, 2024
80.21 MB
Publicly accessible
This repository contains experimental data from a series of fluid injection-induced shearing tests conducted on Utah FORGE granitoid. The experiments were performed using an aluminum triaxial pressure vessel (TEMCO) apparatus at Pennsylvania State University. The primary aim was t...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergytemperatureexperimentpre-stressseismicityutah forgeegsgranitoidtemcotriaxial pressure vesselfault seismicitypre-stress ratioshearpore pressure60-gritinclined fracture

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Assessing Low-Temperature Geothermal Play Types: Relevant Data and Play Fairway Analysis Methods

Jan 01, 2023
17.19 MB
Publicly accessible
This data catalog contains information on low temperature geothermal play types. The U.S. Department of Energy (DOE) Geothermal Technologies Office (GTO) supports the Geothermal Heating and Cooling Geospatial Datasets and Analysis project, conducted by the National Renewable Energ...
Authors
Davalos, E. et al National Renewable Energy Laboratory
geothermalenergylow-temperaturedatasetsgeothermal heating and coolingdata cataloglow temperaturegeospatialgeochemicalprocessed datageophysicaleconomic riskdata repositoryplay fairway analysisplay fairwayalaskahawaiiunited statesexploration risktechnical reportreport

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

DCIF (Directional Cooling-Induced Fracturing) Westerly Granite AE Borehole Damage Effect Test (Task 3-0)

Jan 27, 2022
162.51 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on three rectangular Westerly granite blocks (width=depth=4.0", height=2.0") which were preheated to 200, 400, and 600 degree C to induce damage (microcracks) with varying degrees. Liquid nitrogen was poured...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalenergydirectional cooling induced fracturingdcifdirectional cooling-induced fracturingdamage effect testfracturemicrocrackthermal stressacoustic emissionaccousticsthermal fracturefailure testraw dataprocessed datastressbiaxial stresswesterly graniteborehole damage effecttestwesterlygranite

DCIF Westerly Granite AE Stress Effect Test (Task 3-1)

Jul 08, 2021
216.62 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on rectangular Westerly granite blocks (width=depth=4.0", height=2.0"). Liquid nitrogen was poured in a small, 1"-diameter copper cup attached to the top of the sample, and the resulting acoustic emissions (A...
Authors
Nakagawa, S. and Trzeciak, M. Lawrence Berkeley National Laboratory
geothermalenergythermal fracturingstress measurementfracturingprocessed datageophysicsstress testinggranitewesterly granitestressmicrofracturefracturedatatemperatureacoustic emissionacoustic emission locationacoustic emission rate

GOOML Kahunanui Data Curation, Historical Modeling, Forecast Modeling, and Genetic Optimization Examples

Jan 30, 2023
725.34 MB
Awaiting release
This dataset contains example files and Jupyter Notebooks associated with the Geothermal Operational Optimization using Machine Learning (GOOML) framework, specifically for the fictional Kahunanui (KHN) geothermal power plant. The dataset includes synthetic time series data, confi...
Authors
Taverna, N. et al Upflow
geothermalenergymachine learninggoomlpower plantoptimizationgenetic optimizationregressionneural networkoperationssynthetic datakahunanuiforecasthindcastdata curationinputsoutputsconfigurationexamplephygnnphysics guided neural networkssteamfieldsteam fieldwellsflash plantsprocessed datapythonjupyter notebookmodelmodelingcode

Fallon FORGE: Vs30m Seismic Velocity

Mar 12, 2018
3.53 MB
Publicly accessible
Time-averaged shear-wave velocity to 30 m depth about the Fallon, NV FORGE site.
Authors
Blankenship, D. and Kaven, J. Sandia National Laboratories
geothermalenergyforgeegsfallonseismicityvs30nevadashearwavevelocityvetted-nogeophysicsseismicnvs-wave

Play Fairway Analysis CA-NV-OR: Additional 2km Grid Figures

Aug 05, 2015
21.36 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area. Grids at 2km, updated from 5km.
Authors
Ferguson, C. University of California
geothermaldegree of explorationheat flowdata differencemedicine lakesan emidiopermeabilitypfageologic profilerasterjpeggeoreferencedgeospatial dataheatrankca-nv-orplay fairway analysischaracterizationexplorationcalifornianevadaoregon

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics
123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service