OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 76 - 100 of 168.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"carbonate geothermal system"×
Other×

Training dataset and results for geothermal exploration artificial intelligence, applied to Brady Hot Springs and Desert Peak

Sep 01, 2020
109.94 MB
Publicly accessible
The submission includes the labeled datasets, as ESRI Grid files (.gri, .grd) used for training and classification results for our machine leaning model: brady_som_output.gri, brady_som_output.grd, brady_som_output.* desert_som_output.gri, desert_som_output.grd, desert_som_outpu...
Authors
Moraga, J. et al Colorado School of Mines
geothermalenergygeothermal explorationhydrothermal mineral alterationsland surface temperaturefault densitypsinsarsubsidenceupliftbrady hot springsdesert peaknevadaconvolutional neural networkfallonmachine learningmodelhydrothermalmineraltemperaturerastergeospatial datageotifftraining datatraining dataset

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Validation of Innovative Exploration Technologies for Newberry Volcano: Raw Seismic Data

Jan 01, 2012
Size unavailable
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Seismic data raw taken by Apex Hipoint for 1st test 2012 (data in .ff format)
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalseismic datanewberryoregonvolcanocalderainnovative exploration technologiesseismicraw dataietgeophysicsrawdataexplorationhydrothermalegs

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk

West Flank Coso FORGE: 52B-7 Image and Mud Log

Apr 01, 1992
22.31 MB
Publicly accessible
FMI image log and mud log of well 52B-7
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flank cosowell datacosoimage logmud loggmiboreholedownholeimagingtemperaturegas analysismethaneethanehydrogen sulfidecarbon dioxideco2lithologymineralogydrillingdrill loggeomechanicswell loggingfmiimagewelllogwell log52b-7west flankcalifornia

LiDAR, Granite Springs Valley, Nevada Play Fairway Analysis

Sep 14, 2017
15.31 GB
Publicly accessible
This data is associated with the Nevada Play Fairway project and contains the entire package of LiDAR data for Granite Springs Valley.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergylidarremote sensinghillshadenvnevadagranite springs valleyslopepfaplay fairway analysisbare-earthgisarcgislayer packagegeospatial datagsvnv great basin

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2000
609.93 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageheat extractionpressure managementpressure supportartesian well flowco2 cutworking fluidco2 injection

PoroTomo: Brady Geothermal Field InSAR Data

Jul 11, 2017
Size unavailable
Publicly accessible
Included are links to compressed InSAR pairs covering Brady Geothermal Field for TerraSAR-X (tracks 53, 91, and 167) and Sentinel-1A data. Pairs from the PoroTomo deployment period and pairs forming a minimum spanning tree according to perpendicular baseline are included for Terr...
Authors
Reinisch, E. University of Wisconsin
geothermalenergyinsarporotomobrady hot springsbrady geothermal fieldnevadaterrasar-xtsxsentinel-1as1aland subsidencebradydigital elevation model

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Chemical, Calcium Phosphate Cements for Geothermal Wells Corrosion Protection, Bond Strength and Matrix Self-Healing

Sep 26, 2017
704 kB
Publicly accessible
The data set shows performance of economical calcium phosphate cement (Fondu) blended with fly ash, class F (FAF) in carbon steel corrosion protection tests (corrosion rate, corrosion current and potential), bond and matrix strength, as well as matrix strength recovery after impos...
Authors
Sugama, T. Brookhaven National Laboratory
geothermalenergycarbon steel corrosioncorrosion rateself-healinghigh temperaturehigh temphigh-tempcasingexperimentwellboreintegritycorrosion protectioncomposite

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
475.12 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk : FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageco2 injectionheat extractionpressure managmentpressure supportartesian well flowco2 cutsedimentarypressure managementworking fluid

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
979.58 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk : FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportco2 injectionartesian well flowheat extractionco2 cutsedimentarybrine reinjection

Beowawe Binary Cycle Monthly Production Data 2011-2012

Jan 01, 2012
2.29 MB
Publicly accessible
Monthly data and metadata for the Beowawe Bottoming Cycle Binary project for 2011-2012 period. Excel files for each month are included in the .zip file and provide hourly MW outputs, ambient temps, and inlet and exit temps.
Authors
Lee, V. Beowawe Power LLC
geothermalbeowawebinarybottoming cyclepower plantlow temperature

Poroelastic References

Dec 12, 2014
8.27 kB
Publicly accessible
This file contains a list of relevant references on the Biot theory (forward and inverse approaches), the double-porosity and dual-permeability theory, and seismic wave propagation in fracture porous media, in RIS format, to approach seismic monitoring in a complex fractured porou...
Authors
Morency, C. Lawrence Livermore National Laboratory
geothermalbiot theorydouble porositydual permeabilityfracturebiotrisdouble-porositydual-permeabilityseismic wave propagationporousfracture porous mediaseismic monitoringbrady

Bradys Hot Springs Geothermal Area Build FEM Configuration

Jul 01, 2015
32.27 MB
Publicly accessible
This submission contains mesh information, nodal coordinates, connectivity data, and list of query points for the build FEM configuration.
Authors
Ali, T. University of Wisconsin
geothermalfemmeshnodal coordinatesrotated coordinatesconfigurationconnectivitygeologic database

Brady's Geothermal Field List of Sentinel-1A InSAR Images

Nov 03, 2016
5.24 kB
Publicly accessible
List of Sentinel-1A InSAR images acquired between 2014-11-01 and 2016-10-31, and archived at the link below. NOTE: The user must create an account in order to access the data
Authors
Feigl, K. University of Wisconsin
geothermalinsarsynthetic aperture radarbradyporotomobradys hot springssarradarsynthetic aperturesatellitewinsarterrasar-xtandem-xinterferometricwestern north americaimaging

Hawaii Play Fairway Analysis: Mapped Faults

Jan 01, 2015
3.99 MB
Publicly accessible
Faults combined from USGS 2007 Geologic Map of the State of Hawaii and the USGS Quaternary Fault and Fold database. This data is in shapefile format.
Authors
Lautze, N. University of Hawaii
geothermalfaultshawaiigeologystructuralshapefileshape filearcgisgisgeospatial datapfa

Hawaii Play Fairway Analysis: Mapped Rifts

Jan 01, 2015
163.21 kB
Publicly accessible
Rifts mapped through reviewing the location of dikes and vents on the USGS 2007 Geologic Map of the State of Hawaii, as well as our assessment of topography, and, to a small extent, gravity data. Data is in shapefile format.
Authors
Lautze, N. University of Hawaii
geothermalriftshawaiigeologystructuralshapefileshape filearcgisgisgeospatial datapfa

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Publicly accessible
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Hawaii Play Fairway Analysis: Island Boundaries

Jan 01, 2015
1.36 MB
Publicly accessible
Outline of Hawaiian islands (Kauai, Oahu, Molokai, Kahoolawe, Lanai, Maui, Hawaii) generated from the Geologic Map of the State of Hawaii published by the USGS in 2007.
Authors
Lautze, N. University of Hawaii
geothermalhawaiiboundaryisland boundaryborderkauaioahumolokaikahoolawelanaimauihawaii islandusgsshapefileshape filearcgisgisgeospatial datapfa

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature

AASG Wells Data for the EGS Test Site Planning and Analysis Task

Oct 09, 2013
32.16 MB
Publicly accessible
Temperature measurement data obtained from boreholes for the Association of American State Geologists (AASG) geothermal data project. Typically bottomhole temperatures are recorded from log headers, and this information is provided through a borehole temperature observation servic...
Authors
Augustine, C. National Renewable Energy Laboratory
geothermalwelltemperatureegs test sitebottomholeshpboreholeborehole temperaturedataegsgeospatial data

Geologic and Geophysical Data for Wells Drilled at Raft River Valley, Cassia County, Idaho, in 1977 to 1978 and Data for Wells Drilled Previously

Dec 31, 1978
Size unavailable
Publicly accessible
In order to better define the size of the thermal anomaly in the Raft River Valley, Idaho, the U.S. Geological Survey drilled a series of intermediate-depth (nominal 500-ft depth) wells in 1977 and 1978. This report presents geologic, geophysical, and temperature data for these dr...
Authors
Nathenson, M. et al United States Geological Survey
geothermalraft rivercassia countyidahodrill holeswellstemperature datageophysical datadoi10.3133/ofr20141201open file reportusgsgeiohysicsgeologygeologicdata
<< Previous1234567Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service