OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 51.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Image Logs"×
Website×

Utah FORGE 2439: Well 16B(78)-32 Field-Test Data from Mini-Frac Tests

Jul 02, 2023
2.73 GB
Publicly accessible
This submittal includes the field-test data collected during stress tests conducted in the Utah FORGE 16B(78)-32 wellbore to measure/characterize the stresses in the geothermal reservoir. The type of stress test performed is referred to as a mini-frac test or a micro-frac test. Th...
Authors
Kelley, M. et al Battelle Memorial Institute
geothermalenergygeomechanicsutahforgeminifracstressin-situ stressegsmini-fracstress testgeophysical logimage logacoustic logsonic logfracturinghydraulic fracturingreservoir stressinjectioncaliper logstemperature logsxmac16b78-32baker hughespacker element pressureflowbackpacker element

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Hawthorne Nevada Deep Direct-Use Feasibility Study Data Used for Geothermal Resource Conceptual Modeling and Power Capacity Estimates

Apr 05, 2020
4.1 MB
Publicly accessible
This data submission includes several data components that were used to develop a conceptual model and power capacity-estimates of two low-temperature geothermal resources that define geothermal prospect A at Hawthorne, Nevada. Data are sourced from a combination of legacy publicl...
Authors
Ayling, B. and Hinz, N. Great Basin Center for Geothermal Energy
geothermalenergyhawthornegeochemistryconceptual modeltemperature logsborehole fracture datahawthorne army depotdirect usenevada2-meter temperaturesalteration mineralsptswell datafluid chemistryddutemperaturefracturexrdwater chemistrysurveycuttingsmodelingcapacityestimatesconceptualhwaad-2hwaad-3hwaad-2ageospatial datalow-tempertaurehydrothermalseservoireservoir compartmentalizationpower capacityimage log

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis

Utah FORGE: Well 58-32 Schlumberger FMI Logs DLIS and XML files

Nov 17, 2017
2.4 GB
Publicly accessible
This zipped data set includes Schlumberger FMI logs DLIS and XML files from Utah FORGE deep well 58-32. These include runs 1 (2226-7550 ft) and 2 (7440-7550 ft). Run 3 (7390-7527ft) was acquired during phase 2C.
Authors
Nash, G. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsfmifmi logswell 58-32fmi xmlfmi dlis58-32 fmifullboreformationmicroimagerimagingmicroimagingboreholeloggingloggeophysicsdip set logsutah geothermal58-32welldeepdliswell logxmlutahmilfordegsresourcecharacterizationwell data

Play Fairway Analysis CA-NV-OR: Additional 2km Grid Figures

Aug 05, 2015
21.36 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area. Grids at 2km, updated from 5km.
Authors
Ferguson, C. University of California
geothermaldegree of explorationheat flowdata differencemedicine lakesan emidiopermeabilitypfageologic profilerasterjpeggeoreferencedgeospatial dataheatrankca-nv-orplay fairway analysischaracterizationexplorationcalifornianevadaoregon

Utah FORGE: Updated FMI Fracture Log from Well 16A(78)-32

Apr 17, 2024
308.48 MB
Publicly accessible
This dataset consists of an Excel spreadsheet detailing the fracture picks from a reinterpretation of the formation micro-imaging (FMI) log from Utah FORGE well 16A(78)-32. The provided information details fracture location, geometry, and type. Also included here is a link to the...
Authors
Handwerger, D. Energy and Geoscience Institute at the University of Utah
geothermalenergyfmi logmeasured well depthtrue verticle depthazimuthdip directionfracture typefracture datafractures16a16a78-32utah forgefmiegswell logprocessed data

Utah FORGE: Well 16B(78)-32 Pressure-Temperature Logs March April 2024

Apr 20, 2024
169.22 MB
Publicly accessible
This dataset consists of Baker Hughes Pressure-Temperature gauge readings on fiber optics in Utah FORGE Well 16B(78)-32. This gauge is at a measured depth of 7,056.67 feet. The true vertical depth can be determined from the well survey data, which is linked below. The data consis...
Authors
McLennan, J. and Hughes, B. Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16b78-32well 16butah forgebaker pressure temperature logspressure temperaturetemperaturepressurewell 16b78-32 pressure temperature logswell 16b78-32 temperature logswell 16b78-32 pressure logsfiber opticsbaker hughes

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Utilization Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
9.8 MB
Publicly accessible
This submission of Utilization Analysis data to the Geothermal Data Repository (GDR) node of the National Geothermal Data System (NGDS) is in support of Phase 1 Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin. The submission includes data pertinent to th...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadeep direct usedistrict heatingheat utilizationsurface levelized cost of heatslcohlcohgeothermal play fairway analysisgpfa-abdemandgeophirespfanortheasteastlow temperatureeconomicsrisk factorsplay fairway analysisgeospatial data

Community Geothermal: Soil Conductivity, Borehole Design, Energy Models, and Load Data for a Residential System Development Hinesburg, VT

Aug 30, 2024
743.47 MB
Publicly accessible
This dataset contains materials from the Coalition for Community-Supported Affordable Geothermal Energy Systems (C2SAGES) project, which evaluated the techno-economic feasibility of a community geothermal system for a residential development in Hinesburg, VT. The dataset includes ...
Authors
Jogineedi, R. et al GTI Energy
geothermalenergycommunity geothermalgeothermal sizingborehole testinggeothermal heat pumpworkforce developmentbuilding energy modelingground heat exchangergeothermal network designcommunity engagementcommgeohinesburgvermontmodelicaenergyplusonepipepythonmodelingthermal conductivity testreportenergy modelborehole designhourly energy loadssizinggeothermal loop sizingsystem designdevelopment

DEEPEN 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jun 30, 2023
3.62 GB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. Part of the DEEPEN project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfamodellingmodelingcharacterizationexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponent

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

New Mexico Play Fairway Analysis: Gamma Ray Logs and Heat Generation Calculations for SW New Mexico

Oct 23, 2015
1.43 MB
Publicly accessible
For the New Mexico Play fairway Analysis project, gamma ray geophysical well logs from oil wells penetrating the Proterozoic basement in southwestern New Mexico were digitized. Only the portion of the log in the basement was digitized. The gamma ray logs are converted to heat pro...
Authors
Kelley, S. New Mexico Bureau of Geology and Mineral Resources
geothermalheat generationgamma logssouthwestern new mexicogamma ray logsoil wellsgamma raypfanew mexiconmsouthwestgeophysicsgeophysicalexplorationdownholeboreboreholewell dataheatgeneration

EGS Collab Experiment 1 Stimulation Data

Aug 13, 2020
376.67 MB
Publicly accessible
Stimulation data from Experiment 1 of EGS Collab, which occurred on the 4850 ft level of the Sanford Underground Research Facility (SURF). A detailed description of the stimulation data is provided in the StimulationDataNotes.docx and is also available on the EGS Collab Wiki. A M...
Authors
Knox, H. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegs4850injection ratepressureflowinjection testinjectiontemperaturewell datae1-pe1-iraw data

Appalachian Basin Play Fairway Analysis Analyses and Results

Jul 30, 2016
15.14 MB
Publicly accessible
*This submission updates a 2015 submission for the utilization analysis (https://gdr.openei.org/submissions/623)* The files document the analysis of utilization potential in support of Phase 1 Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin. This 2016 su...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginiapennsylvanianew yorkdeep direct usedistrict heatingheat utilizationsurface levelized cost of heatslcohlcohgeothermal play fairway analysisgpfa-abdemandgeophiresindustrial usersagricultural userscampus and military usersutilizationmemoanalysisrisk factorexample sitescase studiesmaplow-temperaturelow tempgeospatial data

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

Utah FORGE: High-Resolution DAS Microseismic Data from Well 78-32

Oct 20, 2019
7.42 MB
Publicly accessible
This regards a high-resolution DAS microseismic dataset produced by Silixa from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. It is a very large dataset and as such it is currently not directly available on GDR. However, it is availabl...
Authors
Martin, T. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutah geothermalmicroseismic datasilixa microseismic datawell 78-32 microseismic datawell 58-32 stimulation seismicityforge phase 2csilixawell 58-32well 78-32utahmilfordroosevelt hot springssegyseg-ydasdistributed acoustic sensingdxsmicroseismicitydasvmonitoringwell locationwell datadtsdistributed temperature sensingprocessed datageophysicsstimulationraw data

Fallon FORGE: Vs30m Seismic Velocity

Mar 12, 2018
3.53 MB
Publicly accessible
Time-averaged shear-wave velocity to 30 m depth about the Fallon, NV FORGE site.
Authors
Blankenship, D. and Kaven, J. Sandia National Laboratories
geothermalenergyforgeegsfallonseismicityvs30nevadashearwavevelocityvetted-nogeophysicsseismicnvs-wave

EGS Collab Experiment 2: Continuous Broadband Seismic Waveform Data

Sep 12, 2022
17.77 MB
Publicly accessible
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. This dataset includes the NSF SAGE website where seismic waveform data from this experiment can be downloaded. Two broadband seismometers were installed...
Authors
Rodriguez Tribaldos, V. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegswaveformsbroadbandtiltcharacterizationseismicwaveformgeophysicsexperiment 2continuousmonitoring4100 level

Sedimentary Geothermal Feasibility in Eastern Nevada and Millard County, Utah Well Databases

Nov 30, 2019
8.57 MB
Publicly accessible
In order to gather data to assess sedimentary geothermal feasibility in Nevada and Utah, state oil and gas and geothermal databases were serached for well files and well logs. Well data from the Nevada Bureau of Mines and Geology oil and gas and geothermal databases was mined for ...
Authors
Taverna, N. National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitywell datatemperaturepermeabilityformationdepthsedimentary basinpavant butteelko basinsteptoe basinrailroad valleybacon flatmarys riverdiamond valleyblackburnn. willow creeknorth willow creektomera ranchblack rock desertmillard countysedgeo

EGS Collab Experiment 1: Circulation Testing Processed data

Apr 01, 2021
129.85 MB
Publicly accessible
This submission includes processed and reduced data for circulation testing that was conducted at the 164' fracture on the 4850 ft level of the Sanford Underground Research Facility. The circulation tests were done to test the flow through the 164' fracture in the EGS Collab Exper...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalenergyegs collabsurfsanford underground research facilityexperimentegscirculationthermal drawdownprocessed datadata processingpythoncodeinjection testinjection rateinjection pressureflowpressuretemperaturestimulation
123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service