OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 101 - 125 of 147.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"downhole array"×

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

STRESSINVERSE Software for Stress Inversion

Oct 31, 2018
Size unavailable
Publicly accessible
The STRESSINVERSE code uses an iterative method to find the nodal planes most consistent with the stress field given fault frictional properties. STRESINVERSE inverts the strike, rake and dip from moment tensor solutions for the in-situ state of stress. The code iteratively solves...
Authors
Gritto, R. Array Information Technology
geothermalenergystress inversioninversionstressseismicanalysisstressinversejointfault orientationmatlabcodenumericalmomenttensorsoftwarepassivefaultfaultingearthquakeorientationgeophysicsgeophysicalmicroseismicityinducedseismicitystimulationegsinjectionfracturemonitoringhydraulicgeneration

Utah FORGE 3-2535: Preliminary Report on Development of a Reservoir Seismic Velocity Model

Jan 30, 2023
5.8 MB
Publicly accessible
This report describes the development of a preliminary 3D seismic velocity model at the Utah FORGE site and first results from estimating seismic resolution in the generated fracture volume during Stage 3 of the April 2022 stimulation. A preliminary 3D velocity model for the larg...
Authors
Gritto, R. Array Information Technology
geothermalenergy3d seismic velocity modelseismic resolutionseismicgeophysicsreservoirmodelvelocityforgeutah forgeegscharacterizationreportpreliminarymilfordphasenetneural networkingmachine learningdeep learning

Utah FORGE: Development of a Reservoir Seismic Velocity Model and Seismic Resolution Study

Apr 30, 2022
15.3 MB
Publicly accessible
This is data from and a final report on the development of a 3D velocity model for the larger FORGE area and on the seismic resolution in the stimulated fracture volume at the bottom of well 16A-32. The velocity model was developed using RMS velocities of the seismic reflection su...
Authors
Vasco, D. and Chan, C. Array Information Technology
geothermalenergyseismic velocity modelseismic resolution3d p-wave3d s-waveseismicraw dataprocessed datawell 16a-32utah forge

Utah FORGE: Well Acord 1-26 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
91.14 MB
Publicly accessible
This is a compilation of logs and data from Well Acord 1-26 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Logs include: mud log (45'-12645'), compensated densilog (1102'-7923', 7900'-12644'), neutron log (1102'-7923'), dual induction ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egswell logsutah well logsgeothermal wellsutah geothermal wellsroosevelt hot springsroosevelt hot springcement bondgamma rayneutronporositycompensated densilogstratigraphic reportstratigraphypetrographydual inductionacousticacoustilogdensitytemperature logdifferentialsamplegeothermcalipermud logdrillers logwater rightspermission to drilldrilling planbond documentsacordutahacord 1-26well logwell dataresourcecharacterizationmilfordtemperaturedensilogcompensatedcuttings

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

EGS Collab Experiment 2: Distributed Fiber Optic Acoustic Data (DAS)

May 28, 2024
212.2 TB
Publicly accessible
Distributed fiber optic sensing was an important part of the monitoring system for EGS Collab Experiment #2. A single loop of custom fiber package was grouted into the four monitoring boreholes that bracketed the experiment volume. This fiber package contained two multi-mode fiber...
Authors
Rodriguez Tribaldos, V. and Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 2distributed acoustic sensingdassilixaidasterra15trebleoptasenseodh3hdf5tdmsraw datastrain ratemulti-mode fibersingle-mode fibergeophysics

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Data Arrays for Microearthquake (MEQ) Monitoring using Deep Learning for the Newberry EGS Sites

May 05, 2021
11.59 GB
Publicly accessible
The 'Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties' project looks to apply machine learning (ML) methods to Microearthquake (MEQ) data for imaging geothermal reservoir properties and forecasting seismic events, in order to...
Authors
Zhu, T. Pennsylvania State University
geothermalenergycodedeep learningmachine learningaiartificial intelligenceegsenhanced geothermal systemsengineered geothermal systemsnewberryoregonnewberry volcanomlraw dataprocessed datamicroseismicitynumpywaveformpreprocessedpythonnewberry volcanic sitemicroearthquakemeqseismicgeophysicsgeophysical

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Brady's Geothermal Field Analysis of Pressure Data

Mar 17, 2017
10.13 MB
Publicly accessible
*This submission provides corrections to GDR Submissions 844 and 845* Poroelastic Tomography (PoroTomo) by Adjoint Inverse Modeling of Data from Hydrology. The 3 *csv files containing pressure data are the corrected versions of the pressure dataset found in Submission 844. The ...
Authors
Lim, D. University of Wisconsin
geothermalenergyproduction flow rate datainjection flow rate datapressure datahydrologyhydrogeologybrady hot springsporotomoporoelastic tomographyegsenhanced geothermal systemsengineered geothermal systemsdeployment databradybradys geothermal fieldpressureflow rateboreholedownholewell datapressure sensorobservation wellspumping testwater pressureobservation well

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Utah FORGE 6-3712: Report on a Data Foundation for Real-Time Identification of Microseismic Events

Jan 21, 2025
971.63 kB
Publicly accessible
This submission is a technical report for the Probabilistic Estimation of Seismic Response Using Physics Informed Recurrent Neural Networks project. The report describes the process of extracting events from the borehole seismic sensors. To be effective once deployed, the process ...
Authors
Williams, J. et al Global Technology Connection, Inc.
geothermalenergyutah forgedata processingmachine learninginduced seismicitytechnical reportevent detectionmlartificial intelligenceaireal-timephysics informedrecurrent neural networksborehole seismicseismic datamicroseismicevent catalogmagnitude-frequency distributiongeophysicsegs

3D Model of the Tuscarora Geothermal Area

Dec 31, 2013
43.8 MB
Publicly accessible
The Tuscarora geothermal system sits within a ~15 km wide left-step in a major west-dipping range-bounding normal fault system. The step over is defined by the Independence Mountains fault zone and the Bull Runs Mountains fault zone which overlap along strike. Strain is transferre...
Authors
E., J. University of Nevada
geothermal3d modeltuscarora geothermal areafaultingfaultsstratigraphystratigraphic unitscross-sectioncross sectiongeologygeologic unitsgeologic contacttuscaroradatageospatial data

EGS Collab Experiment 2: Distributed Fiber Optic Temperature Data (DTS)

Nov 08, 2022
2.77 GB
Publicly accessible
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. Distributed fiber optic sensing temperature data is included in this dataset for this experiment. A single loop of custom fiber package was grouted into ...
Authors
Rodriguez Tribaldos, V. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdfosfiber opticxt-dtstemperaturedtsexperiment 2distributed sensingmonitoringcharacterization

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Oilwell Conversion (Well API 121913310501) to Geothermal Heat Storage Well for Flexible Electricity Storage

May 05, 2021
2.86 GB
Publicly accessible
Geothermal growth is limited by a lack of geographically dispersed high-temperature thermal resources and high initial upfront investment in characterization and well construction. This project intended to address the challenges of energy supply intermittency and enhance grid resi...
Authors
Malkewicz, N. et al University of Illinois
geothermalenergycypress reservoirgeothermal modellingoilwell conversioninjection/extraction testingenergy storagegeothermal energy storagewell conversionheat storageheat storage wellsheat injectiongamma ray logspressure testtemperature datasubsurface thermalthermal storagesubsurface thermal storage

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service