OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 101 - 125 of 191.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"seismic traffic light systems"×
Seismic×

Map of Validation of Innovative Exploration Technologies for Newberry Volcano

Jul 01, 2012
3.18 MB
Publicly accessible
A map showing location of wells permitted, drilled and seismic test, as part of validation of innovative exploration technologies done for the Newberry Volcano project in 2012.
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalmapsdrillingnewberryoregonvolcanocalderaexplorationdavenportmapietwelllocationpermitsseismicwell locationhydrothermalegs

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

EGS Collab Experiment 1: 3D Seismic Velocity Model and Updated Microseismic Catalog Using Transfer-Learning Aided Double-Difference Tomography

Apr 20, 2020
6.74 MB
Publicly accessible
This package contains a 3D Seismic velocity model and an updated microseismic catalog associated with a proceedings paper (Chai et al., 2020) published in the 45th Workshop on Geothermal Reservoir Engineering. The 3D_seismic_velocity_model text file contains x (m), y(m), z(m), P-w...
Authors
Chai, C. et al Oak Ridge National Laboratory
geothermalenergyegs collab3d seismic structuretransfer learningdeep learningmachine learninginteractivesurfp-waves-wavemicroseismic catalogseismic tomographyinteractive visualizationgeophysicsmodelingvelocitymodelmicroseismicitycatalogtransfer-learningdouble-difference tomography3dseismicmeqprocessed datageospatial data

Utah FORGE 6-3712: Report on a Data Foundation for Real-Time Identification of Microseismic Events

Jan 21, 2025
971.63 kB
Publicly accessible
This submission is a technical report for the Probabilistic Estimation of Seismic Response Using Physics Informed Recurrent Neural Networks project. The report describes the process of extracting events from the borehole seismic sensors. To be effective once deployed, the process ...
Authors
Williams, J. et al Global Technology Connection, Inc.
geothermalenergyutah forgedata processingmachine learninginduced seismicitytechnical reportevent detectionmlartificial intelligenceaireal-timephysics informedrecurrent neural networksborehole seismicseismic datamicroseismicevent catalogmagnitude-frequency distributiongeophysicsegs

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

EGS Collab Experiment 1: In-situ observation of pre-, co and post-seismic shear slip preceding hydraulic fracturing

May 22, 2018
136.27 MB
Publicly accessible
Understanding the initiation and arrest of earthquakes is one of the long-standing challenges of seismology. Here we report on direct observations of borehole displacement by a meter-sized shear rupture induced by pressurization of metamorphic rock at 1.5 km depth. We observed the...
Authors
Guglielmi, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyegsegs collabsurfsanford underground research facilityseismicinjection teststimulationslip vectorshearaxialdisplacementpressureborehole displacementdeformationsimfipprobeboreholee1-ipre-slipco-seismicslippost-seismicaftersliphydraulicfracturingin-situ

Bradys Hot Springs Ambient Noise Correlation Functions (Initial Waveforms)

Jul 01, 2015
34.08 MB
Publicly accessible
These files are ambient noise correlation (ANC) functions calculated for 11 days of continuous seismic data recorded by the Lawrence Berkeley network in the Brady geothermal field. These are SAC formatted seismic waveforms. The stations included are BPB04, BPB05, BPB07, BPB08, BP...
Authors
Matzel, E. Lawrence Livermore National Laboratory
geothermalambient noise correlationseismicbrady geothermal fieldseismic waveformsambient noise brady geothermalbradybradys hot springsporotomoancfunctions

WHOLESCALE: Seismic Waveform Data from San Emidio, Nevada 2022

Apr 05, 2022
15.32 kB
Publicly accessible
Included here is a link to seismic waveform data collected at San Emidio, Nevada in 2022. The seismic instruments used were provided by EarthScope Consortium through the EarthScope Primary Instrument Center at New Mexico Tech. Data collected are available here through EarthScope ...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescalesmartsolosan emidionevadadldraw dataearthscopeseismographgeophysicsseismicityearthquakemonitoringpumpingseismologyfdsneerepasscalsacseismic datawaveform

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Utah FORGE: 2024 Stimulations Microseismic Event Catalog from Seismic Surface Network

Jul 29, 2024
Size unavailable
Publicly accessible
This archive provides a a link to a microseismic event catalog of the 2024 stimulations at Utah FORGE. The catalog was derived from data collected with the surface monitoring network consisting of 5 permanent seismic stations deployed by the University of Utah Seismograph Station...
Authors
Niemz, P. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic dataseismicstimulationwell 16b78-32 stimulationseismicitystimulation seismic dataegs2024 stimulationcatalogmicroseismic event catalogevent catalogsurface monitoring networkgeophysicsmagnitude calibrationresearch articleprocessed datadata catalogseismograph stationshydraulic fracturingreservoir engineering

Utah FORGE: Earthquake Information and Data

Feb 29, 2016
Size unavailable
Publicly accessible
This site contains information and data related to Utah earthquakes. It is maintained by the USGS Earthquake Hazards Program. This site contains information relevant to the Utah FORGE project.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah earthquakesearthquakesforgeutah forgeseismic eventsutah seismic eventsegsseismicityseismic monitoringseismologyutahearthquakedataeventroosevelt hot springsmilford

Brady's Geothermal Field Reftek Seismometer Data

Mar 30, 2016
Size unavailable
Publicly accessible
Continuous seismic recordings from six Reftek seismometers deployed at Bradys Hot Springs geothermal field in Nevada from March 9th to 30th, 2016. Data is archived in mseed format. Five of the six stations are under a moratorium.
Authors
Feigl, K. University of Wisconsin
geothermalporotomopassive seismicbradys hot springsnevadareftekseismometerseismicarraybradyseismicitymonitoringnvpassive source

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

West Flank Coso FORGE: ArcGIS Data for Geologic Model

Mar 01, 2016
154.12 kB
Publicly accessible
Archive of ArcGIS data from the West Flank FORGE site located in Coso, California. Archive contains the following eight shapefiles: Polygon of the 3D geologic model (WestFlank3DGeologicModelExtent) Polylines of the traces 3D modeled faults (WestFlank3DModeledFaultTraces) Polyline...
Authors
Sandia National Laboratories
geothermalforgewest flankegscosoarcgis datacross-sectionseismic reflectionwell pathwell collarfault tracewell pathswell collarsgeospatial datamodelgeologygeologicfaulttracecalifornia

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

Utah FORGE: DAS Microseismic Event Records From April 2024 Stimulation Experiment

Mar 25, 2026
1.29 TB
In curation
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (raw waveforms) recorded during the 16A-16B stimulations conducted at the Utah FORGE site in April 2024. The dataset consists of raw waveform data provided in nanostrain rate units, accompanied by...
Authors
Ajo-Franklin, J. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdistributed acoustic sensingdasfiber optic monitoringdfosmicroseismicforgewaveformraw datastimulationevent triggersfiber opticgeophysicsgeomechanicshydraulic stimulationhydraulic fracturingdas channel locationssgyseg-ysilixacarinafogmore

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Site Earthquake Animation

Mar 13, 2016
1.14 MB
Publicly accessible
This is a .kml earthquake animation covering the period of 1991 2011 for the Utah Milford FORGE site. It displays seismic events using different sized bubbles according to magnitude. It covers the general Utah FORGE area (large shaded rectangle) with the final site displayed as a ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsearthquakesgeospatialsimulationseismologyarcgisgoogle earthseismicityseismic monitoringbackgroundutahgeospatial dataearthquakeanimationtime lapseeventmagnitude

Utah FORGE: Leapfrog 3D Geologic Movie

May 18, 2018
Size unavailable
Publicly accessible
This is a 3D geological movie of the Utah FORGE area created with Leapfrog Geothermal 3D modelling software. The movie shows the Utah FORGE site, wells, seismic and lithologic cross-sections, and rock unit tops. This illustrates the thick crystalline granitoid EGS reservoir.
Authors
Podgorney, R. Energy and Geoscience Institute at the University of Utah
geothermalenergy3d geologyutah forgeutahroosevelt hot springsgeologic movieleapfrog movieforgeegsmodelgeologicleapfrogwellsseismiccross sectionformation topsgeologystructuralmodeling3dmoviemilfordreservoirgranitoidcrystalline

Utah FORGE: 2023 Phase 3B Year 1 Annual Report

Aug 09, 2023
15.64 MB
Publicly accessible
This report discusses the objectives, goals, accomplishments and results of Phase 3B Year 1 of the Utah FORGE project. The report includes infrastructure, seismic monitoring, modelling, external R&D, communications and outreach, data produced, lessons learned, conclusions, and pla...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeseismic monitoringinfrastructuremodellingrdcommunicationsoutreachannual reportplansdatamtmagnetotelluricphase 3bmilfordegsstimulationtracerinjectiongeophysicsmicroseismicforge reportssite operationsresource developmenttechnology development

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

Sedimentary Geothermal Feasibility in Nevada, Western Utah, Colorado, and the Gulf Coast Region of Texas Final Report

Jul 01, 2020
Size unavailable
Publicly accessible
The objectives of this project were to (1) perform a literature review of sedimentary geothermal resources, (2) identify data sources and develop data-collection methodologies that characterize selected resources, (3) screen sedimentary basins and formations for sedimentary geothe...
Authors
Johnston, H. et al National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitysedimentary basinelko basinrailroad valleysteptoe valleypavant buttedenver basinpiceance basinraton basingulf coast regionnevadautahtexasgbcaasgreat basin carbonate and alluvial aquifer systemcarbonateagsadvanced geothermal systembottom-hole temperaturewell datalcoeeconomicsupperlowercarbonate aquifer unitegsenhanced geothermal systemplay fairway analysiscoloradotemperaturebottom-holemarys river basindrillingpermeabilityreservoirmodelingcarbonate geothermal systemcgstechno-economicanalysisdownselectsubsurfacedata mininggeologygradientheatflowgeophysicsseismicclosed-loophydrogeologycoststructuralbedrockmapaquifersedgeo

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

Utah FORGE: Source Imaging DAS-Based Seismic Event Catalog April 2024 Stimulation

Aug 26, 2025
140.41 kB
Publicly accessible
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a DAS-specific source imaging workflow that avoids conventional phase picking. Instead, STA/LTA-transformed DAS and downhole...
Authors
Dvory, N. et al The University Of Utah
geothermalenergyforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationapril 2024 stimulation
<< Previous12345678Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service