OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 189.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"data reduction"×
Stimulation and Microseismicity×

Utah FORGE: Neubrex Well 16B(78)-32 DAS Data April 2024

Oct 01, 2024
97.48 TB
Publicly accessible
This dataset comprises Distributed Acoustic Sensing (DAS) data collected from the Utah FORGE monitoring well 16B(78)-32 (the producer well) during hydraulic fracture stimulation operations conducted in April 2024. The data were acquired continuously over the stimulation period at ...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergydasacoustic sensingmicroseismiccrosswell strain ratefracture driven interactionsfdidistributed acoustic sensinginjection allocationstrain rateutah forgeegsstimulation16b 78-3216a 78-32mircroseismicityneubrexraw datahdf5h5time gated

Utah FORGE: Laboratory Fault Reactivation and Permeability Evolution During Fluid Injection

Sep 15, 2025
182.35 GB
Publicly accessible
This dataset contains results from controlled shear reactivation experiments performed on cylindrical Westerly and granitoid granite samples with a single inclined fracture. Laboratory faults were pre-loaded near failure and reactivated by fluid injection to examine relationships ...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergyinduced seismicityutah forgewesterly granitegranitoidpermeabilityshear stimulationegsfault reactivationfluid injectionpermeability evolutionseismicityacoustic emissionssingle inclined fractureshear stresspore pressuretriaxial testingmechanical datageomechanicsraw dataprocessed dataacoustic data

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Utah FORGE: Well 16A(78)-32 Stimulation Tracer Test Results

Sep 16, 2022
7.45 MB
Publicly accessible
This archive contains data from the tracer test performed during the Utah FORGE well 16A(78)-32 stimulation. This includes: the raw data file from Pason in the csv format, a one-page Word document from Pason that explains the headers and units used in their data file, an Excel spr...
Authors
Rose, P. and Barker, B. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge16a78-3216a78-32 stimulation tracer test16a78-32 tracer test16a78-32 tracertracer testutah forge tracer testsutah forge tracerwell 16a78-32 stimulationstimulationegsforgemass recoveryconcentration chartsconcentration datapasonflowwell datatracer recovery

Utah FORGE 5-2615: Laboratory Data for Insights on Hydraulic Fracture Closure and Stress Measurement

Jun 12, 2024
4.82 MB
Publicly accessible
This dataset includes data from injection/fall-off experiments conducted in controlled laboratory settings. The aim is to investigate the physics governing fracture closure and the associated stress measurements during hydraulic fracturing. These time series data include flow rat...
Authors
Ye, Z. and Ghassemi, A. University of Oklahoma
hydraulic fracturinginjection/fall-off testsin-situ stress measurementsfracture closuregeothermalegsutah forgeminifracstressflow ratepressurevolumelaboratoryenergyinjectionfall-offwater injectionoil injectionsierra white granitecrab orchard sandstonescioto sandstonekismetgeomechanics

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

Active Source Seismic (Ultrasonic) Data from Double-Direct Shear Lab Experiments

May 05, 2021
Size unavailable
Publicly accessible
Active source ultrasonic data from lab experiments p5270 and p5271 including raw waveforms (WF) and mechanical data (mat). From the PSU team working on the "Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties" project. The fric...
Authors
Marone, C. Pennsylvania State University
geothermalenergyseismicactive sourcelaboratoryfriction experimentultrasonicgeophysicsmicroseismicitylab dataraw datawaveformsmechanical datapreprocessedmatlabacousticsacousticbiaxial testing apparatusultrasonic acoustic monitoring systemmachine learningdeep learningaiartificial intelligenceseismic forecastingearthquake forecastingfault

Utah FORGE: Fiber Optic Cumulative Strain Change and Strain Change Rate Data From Well 16A Stimulation at Well 16B

Nov 06, 2024
2.83 GB
Publicly accessible
This dataset includes Rayleigh Frequency Shift (RFS) Distributed Strain Sensing (DSS) cumulative strain change and change rate data. The data was acquired during the stimulation of Utah FORGE Well 16A(78)-32 in April 2024 via fiber installed in Well 16B(78)-32. The fiber optic da...
Authors
Khatara, S. et al Neubrex Energy Services (US), LLC
geothermalenergyh5hdf5rayleigh frequency shiftrfsdssdistributed strain sensingfiber optic sensingneubrexsr7000utah forgeegsstimulationfar field strain changestrain responsecumulative strainstrain change rate16a16bhydraulic fracturingprocessed datageophysicsstrainstrain ratefractures

Utah FORGE: DAS Microseismic Event Records From April 2024 Stimulation Experiment

Mar 25, 2026
1.29 TB
In curation
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (raw waveforms) recorded during the 16A-16B stimulations conducted at the Utah FORGE site in April 2024. The dataset consists of raw waveform data provided in nanostrain rate units, accompanied by...
Authors
Ajo-Franklin, J. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdistributed acoustic sensingdasfiber optic monitoringdfosmicroseismicforgewaveformraw datastimulationevent triggersfiber opticgeophysicsgeomechanicshydraulic stimulationhydraulic fracturingdas channel locationssgyseg-ysilixacarinafogmore

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Data Arrays for Microearthquake (MEQ) Monitoring using Deep Learning for the Newberry EGS Sites

May 05, 2021
11.59 GB
Publicly accessible
The 'Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties' project looks to apply machine learning (ML) methods to Microearthquake (MEQ) data for imaging geothermal reservoir properties and forecasting seismic events, in order to...
Authors
Zhu, T. Pennsylvania State University
geothermalenergycodedeep learningmachine learningaiartificial intelligenceegsenhanced geothermal systemsengineered geothermal systemsnewberryoregonnewberry volcanomlraw dataprocessed datamicroseismicitynumpywaveformpreprocessedpythonnewberry volcanic sitemicroearthquakemeqseismicgeophysicsgeophysical

Utah FORGE: High-Resolution DAS Microseismic Data from Well 78-32

Oct 20, 2019
7.42 MB
Publicly accessible
This regards a high-resolution DAS microseismic dataset produced by Silixa from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. It is a very large dataset and as such it is currently not directly available on GDR. However, it is availabl...
Authors
Martin, T. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutah geothermalmicroseismic datasilixa microseismic datawell 78-32 microseismic datawell 58-32 stimulation seismicityforge phase 2csilixawell 58-32well 78-32utahmilfordroosevelt hot springssegyseg-ydasdistributed acoustic sensingdxsmicroseismicitydasvmonitoringwell locationwell datadtsdistributed temperature sensingprocessed datageophysicsstimulationraw data

Cape EGS: Frisco Pad Wells Flow Test Microseismic Data

Nov 06, 2024
136.79 GB
Awaiting release
This dataset contains microseismic data acquired during the Frisco pad flow test project led by Fervo Energy, conducted between July 17th Aug 12th 2024, near the Utah FORGE geothermal site. The microseismic data was collected from various Utah FORGE wells: via Distributed Acoustic...
Authors
Dadi, S. and Kanu, O. Fervo Energy
geothermalenergycape egsutah forgemicroseismicfriscodasdistributed acoustic sensing3cthree componentgeophone16bsta/ltasegyflow testegsmilfordutahmicroseismic eventevent detectiontestingdevelopmentreservoir engineering

GEISER Project The Geysers Seismic Broadband Data 2012 2013

Oct 31, 2018
Size unavailable
Publicly accessible
This link points to the Northern California Earthquake Data Center (NCEDC) to access The Geysers seismic broadband data. The two available data sets consist of continuous waveform data recorded at The Geysers from July 2012 to July 2013 and a processed catalog with earthquake info...
Authors
Gritto, R. Array Information Technology
geothermalenergyseismic broadband dataseismicmicroseismiccontinuousinducedseismicitymicroseismicitymonitoringeventnetworkegsgeyserscacaliforniaarrivalearthquakegeisergeothermal engineering integrating mitigation of induced seismicity in reservoirsmitigationreservoirsstimulationresourcedevelopmenthydraulic

EGS Collab Experiment 1: Circulation Testing

Apr 01, 2019
965.21 MB
Publicly accessible
These data and test descriptions comprise a chilled circulation test conducted at the 164' fracture in the EGS Collab Experiment 1 testbed on the 4850 ft level of the Sanford Underground Research Facility. Descriptions of the meta data, design drawings for the flow testing system,...
Authors
Knox, H. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsraw dataflowflow testingstim and flow systemfield testingwellinjectionproductionleadsouth dakota

Hydroshear Simulation Lab Test 3.2

Aug 01, 2014
5.88 MB
Publicly accessible
This data file is for the hydroshear simulation lab test 3.2. The two previous hydroshear simulation lab tests are linked in the resources section as GDR submissions. In this test a sample of granite with a pre-cut (man made fracture) is confined, heated and differential stress is...
Authors
Bauer, S. Sandia National Laboratories
geothermalhydroshearstimulationgranitelab testprecut fracturegeophysicsshearshear testinghydroshear testingdifferential stresssimulationfractureegs

Project Red: Well 34-22 Stimulation Treatment Data 2022

Aug 06, 2025
11.89 MB
Awaiting release
This dataset contains stimulation treatment data collected by Fervo Energy from Well 34-22 in the Red Field, Nevada in July, 2022. The experiment involved 16 multicluster plug-and-perf stages, with measurements recorded in consistent time intervals. Data fields include elapsed tim...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyegsproject redfervored fieldnevadastimulationhydraulic stimulationplug-and-perfmulticlusterbottomhole pressuresurface treating pressureslurry ratepsibarrels per minutetime serieswell treatment datageothermal stimulaitonjuly 2022raw data

Utah FORGE 3-2417: DAS Microseismic Event Catalog from April 2024 Stimulation

Jun 09, 2025
9.11 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog and 3D velocity model from DAS acquisition conducted during the 16A stimulations that took place between April 3rd and April 7th, 2024. The catalog consists of multiple CSV files, each named after the associated s...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalfogmoreevent catalogcatalogmicroseismic eventsilixadistributed acoustic sensingidas16astimulationprocessed datavelocity modeldelano

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

Utah FORGE: Fault Shear Reactivation Experimental Data for Fluid Injection-Rate Controls on Seismic Moment

Nov 07, 2023
12.98 MB
Publicly accessible
Included are experimental data recorded from shear experiments that specifically explore the link between fluid-injection rate and seismic moment resulting from shear reactivation of laboratory faults. Raw mechanical data from three experiments are included alongside corresponding...
Authors
Roseboom, M. et al Pennsylvania State University
geothermalenergyinduced seismicityinjection rateegsseismic momentgeomechanicsgeophysicsutah forgeshearmatlabshear experimentsraw datacodecore experimenttemcoconfining pressurepore pressureaxial pressureshear displacementfracturealong-fault pressureconstant shear stress

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

EGS Collab Experiment 1: Common Discrete Fracture Network

Sep 18, 2019
5.69 MB
Publicly accessible
This package includes data and models that support hydraulic fracture stimulation and fluid circulation experiments in the Sanford Underground Research Facility (SURF). A paper by Schwering et al. (2020) describes the deterministic basis for developing a "common" discrete fracture...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsgeophysicsfracturenetworkdiscrete fracture networkdfnfluidflowmodeldatafluid circulationboreholeweepcoresystemenhanced geothermal systemsandia national laboratorieselectrical resistivitywellinjection testtracerdrilling
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service