OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 54.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"digital elevation map"×
Seismic×

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Brady's Geothermal Field Reftek Seismometer Data

Mar 30, 2016
Size unavailable
Publicly accessible
Continuous seismic recordings from six Reftek seismometers deployed at Bradys Hot Springs geothermal field in Nevada from March 9th to 30th, 2016. Data is archived in mseed format. Five of the six stations are under a moratorium.
Authors
Feigl, K. University of Wisconsin
geothermalporotomopassive seismicbradys hot springsnevadareftekseismometerseismicarraybradyseismicitymonitoringnvpassive source

Utah FORGE: Seismograph Station Information and Data

Jan 26, 2021
Size unavailable
Publicly accessible
This link leads to the University of Utah Seismograph Stations website Utah FORGE seismograph stations page. This page contains a location map and description of the Utah FORGE seismograph stations and other related information. Additionally, data can be downloaded for each statio...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalforgeutah forgewell 68-32 seismic datautah forge seismograph stationsuniversity of utah seismograph stationsutah seismograph stationsuniversity of utahegsmilfordutahroosevelt hot springsseismographstationsseismicboreholewebicordergeophysics

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

West Flank Coso FORGE: Seismic Reflection

May 16, 2016
14.82 MB
Publicly accessible
PDFs of seismic reflection profiles 101,110, 111 local to the West Flank FORGE site. 45 line kilometers of seismic reflection data are processed data collected in 2001 through the use of vibroseis trucks. The initial analysis and interpretation of these data was performed by Unru...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgewest flankseismic reflectionsurvey mapwaveprestack kirchoff migrationseismic profilescososeismicgeophysicscalifornia

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Newberry Caldera Conceptual Geologic Model

Mar 04, 2016
Size unavailable
Publicly accessible
Conceptual model for the Newberry Caldera geothermal area. Model is centered around caldera and evaluates geologic information in tandem with some geophysical datasets to derive a conceptual subsurface model. Includes: Geologic information from the USGS geologic map of Newberry...
Authors
Moser, M. et al National Energy Technology Laboratory
geothermalgeologic modelegsenhanced geothermal systemnewgennewberryoregonfaultsstructureseismicconceptual modelsubsurface modelgeologygeologicalmodelconceptual

Nevada Great Basin Play Fairway Analysis Reports & Appendices

Oct 28, 2015
52.81 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. et al Nevada Bureau of Mines and Geology
geothermalnevadaplay fairwayreportappendicesgreat basinnbmgnvpfacarson sinksteptoe valleygeophysicsgeophysicalgeologygeologiclidargeochemicalgravityseismic reflectionmtmagnetotelluricsgeodeticgeodesyshallow temperaturesoil gasslip and dilation tendancy3d modelingthermal modelingexplorationresource assessmentresource potentialinvestigationsurveypreliminarysite assessmentfavorabilitynv great basin

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

Utah FORGE: Neubrex Well 16B(78)-32 DAS Data April 2024

Oct 01, 2024
97.48 TB
Publicly accessible
This dataset comprises Distributed Acoustic Sensing (DAS) data collected from the Utah FORGE monitoring well 16B(78)-32 (the producer well) during hydraulic fracture stimulation operations conducted in April 2024. The data were acquired continuously over the stimulation period at ...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergydasacoustic sensingmicroseismiccrosswell strain ratefracture driven interactionsfdidistributed acoustic sensinginjection allocationstrain rateutah forgeegsstimulation16b 78-3216a 78-32mircroseismicityneubrexraw datahdf5h5time gated

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Hawaii Play Fairway Analysis: USGS Quaternary Fault and Fold Database

Jan 01, 2015
Size unavailable
Publicly accessible
This database contains information on faults and associated folds in the United States that are believed to be sources of M>6 earthquakes during the Quaternary (the past 1,600,000 years). Maps of these geologic structures are linked to detailed descriptions and references. Used t...
Authors
Lautze, N. University of Hawaii
geothermalfaultshawaiiusgsfaultdatabasefoldstructuralfeaturesgeologygeologicseismicityactivequaternarygeologic unitpfa

Washington Geothermal Play Fairway Analysis Heat, Permeability, and Fracture Model Data

Dec 07, 2017
283.19 MB
Publicly accessible
This submission contains raster and vector data for the entire state of Washington, with specific emphasis on the three geothermal play fairway sites: Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV), and Mount Baker (MB). Data are provided for 3 major geothermal mo...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay fairwaywashingtonmodelconfidencefavorabilityriskmtmagnetotelluricsseismicityseismicvelocityp-waves-wavegeothermometryintrusive rockspringstemperature gradientvolcanic ventsland useprocess watertransmissionurbanwatergroundwatergeophysicsfaultslipdilationtendancycoulomb shear stressslip gradientpoly3dpfashapefilesarcgisshape filegeospatial datamodelingmappingintegratedinverseinversionwashington state

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Utah FORGE 3-2417: DAS Microseismic Event Records From Circulation Test July 2023

Jul 09, 2025
17.07 GB
Publicly accessible
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (waveforms) recorded during the 16A-16B circulation tests conducted at the Utah FORGE site in July 2023 as part of the FOGMORE R&D project (Utah FORGE Project 3-2417). Data were acquired using Sil...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdasdistributed acoustic sensingmicroseismiccirculation testfiber optic monitoringsilixa carinasilixa idas v2nanostrain rateseismic dataseg-yjuly 2023raw datatriggeredchannel map

Fault Information and Seismicity for the Portland Basin Deep Direct-Use Feasibility Study

Dec 04, 2018
62.49 MB
Publicly accessible
Included in this dataset is a spreadsheet with the primary fault information used in the basin model, a spreadsheet with earthquake magnitude estimates, and a figure showing location of faults and microseismicity in the Portland Basin
Authors
Streig, A. and Wells, R. Portland State University
geothermalenergyddudeep direct-usethermal energy storageddu-tesseismicityearthquakefaultstructural geologymagnitudeeventmicroseismicityportlandbasinoregonormodelfeasibilityoatfield faulteast bank faultgales creek faultmount angel faultnewberg faultfrontal faultbolton faultcanby-molalla faulthelvetia faultbeaverton faultsherwood faultdip directiondip anglefault length

Appalachian Basin Play Fairway Analysis: Revised 2016 Combined Risk Factor Analysis

Nov 15, 2016
26.7 MB
Publicly accessible
This submission contains information used to compute the combined risk factors for deep geothermal energy opportunities in the Appalachian Basin, in the context of a the Play Fairway Analysis project. The risk factors are sedimentary rock reservoir quality, thermal resource qualit...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginiapennsylvanianew yorkdeep direct usedistrict heatinggeothermal play fairway analysisgpfa-ablow-temperaturecombined risk segment mapsrisk analysisrisk factormapgeologicthermalreservoirseismicutilizationseismicitythermal qualitiesrastertiffgeotiffgeospatial datalow temp

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

WHOLESCALE: Seismic Waveform Data from San Emidio, Nevada 2022

Apr 05, 2022
15.32 kB
Publicly accessible
Included here is a link to seismic waveform data collected at San Emidio, Nevada in 2022. The seismic instruments used were provided by EarthScope Consortium through the EarthScope Primary Instrument Center at New Mexico Tech. Data collected are available here through EarthScope ...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescalesmartsolosan emidionevadadldraw dataearthscopeseismographgeophysicsseismicityearthquakemonitoringpumpingseismologyfdsneerepasscalsacseismic datawaveform
<< Previous123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service