OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 65.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"energy systems modeling"×
Gravity×

Gravity Survey of the Carson Sink Data and Maps

Dec 31, 2013
715.03 MB
Publicly accessible
A detailed gravity survey was carried out for the entire Carson Sink in western Nevada (Figure 1) through a subcontract to Zonge Engineering, Inc. The Carson Sink is a large composite basin containing three known, blind high-temperature geothermal systems (Fallon Airbase, Stillwat...
Authors
E., J. University of Nevada
geothermalcarson sinkbasin and rangegravity studygravity modeldepth to basementnevadagreat basindepth to basmentfallon airbasestillwatersoda lakegravity surveygeophysicscomplete bouger anomalybouger anomalydatageospatial data

Peer Review Presentation: Blind Geothermal System Exploration in Active Volcanic Environments

May 19, 2010
910.73 kB
Publicly accessible
Geothermal Technologies Program Peer Review Presentation on Blind Geothermal System Exploration in Active Volcanic Environments. Includes plans and statuses for multi-phase geophysical and geochemical surveys in overt and subtle volcanic systems in Hawaii and Maui.
Authors
Martini, B. Ormat Nevada Inc
geothermalexplorationblind geothermal systemsmauihawaiivolcanicgeophysicalgeochemicaltimelinebudgetgravityco2 fluxsoil temperaturehyperspectralisotopeaeromagneticpunaulupalakuahaleakalarift zone

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data

Newberry Combined Gravity 2016

Jan 22, 2016
281.27 kB
Publicly accessible
Newberry combined gravity from Zonge Int'l, processed for the EGS stimulation project at well 55-29. Includes data from both Davenport 2006 collection and for OSU/4D EGS monitoring 2012 collection. Locations are NAD83, UTM Zone 10 North, meters. Elevation is NAVD88. Gravity in ...
Authors
Rose, K. National Energy Technology Laboratory
geothermalenhanced geothermal systemegsnewgennewberryoregongravitygeophysicsbougueranomaly

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

Fallon FORGE: Gravity and Magnetics Data

Mar 09, 2018
5.68 MB
Publicly accessible
This package contains principal facts for new gravity data collected September November 2017 in support of the Fallon FORGE project. Also included are rock core density and magnetic susceptibility data for key core intervals, used in modeling 2D and 3D gravity inversions. Indivi...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallongravitynevadadensitymagnetic susceptibilityvetted-nonvmagneticsbch-3foh-2sw51-20bunejug mountains3dinversiongeophysicsgravmagrock densityinverse modelgeospatial datadata

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Utah FORGE: UGS Interactive Geoscience Map

Jan 01, 2021
Size unavailable
Publicly accessible
This is a link to the Utah Geological Survey's Utah FORGE Interactive Geoscience Map. The map layers include information on geology, geography, subsurface temperatures, seismicity, gravity and groundwater. Instructions for using the interactive map and a legend for the interactive...
Authors
Hill, J. Utah Geological Survey
geothermalenergyutah forgeinteractive mapgeology mapgravity maptemperature mapseismicity mapgroundwater mapugs mapsutah geological survey mapsutah forge mapsmapgeologyseismiclstgroundwaterhydrologyugsutahforgeinteractivegravityprocessed datageospatial datawater table depthgroundwater chemistrywellfaultwell temperaturetemperaturebedrockbedrock surfacebeddingfoliationcontactgeographycharcterizationegsmilfordroosevelt hot springsenhance geothermal systemengineered geothermal system

Snake River Plain Play Fairway Analysis: Mountain Home Geothermal Area Natural State Model

Jul 28, 2015
19.23 MB
Publicly accessible
The Mountain Home area is characterized by high heat flow and temperature gradient. Temperature data are available from 18 boreholes with depths equal to or greater than 200 m, 5 of which have depths ranging from ~1340 m to ~3390 m (MH-1, MH-2, Bostic1, Lawrence D No.1, and Anschu...
Authors
Garg, S. et al Utah State University
snake river mountain home modelinggeothermalenergysnake river plainmountain homenumerical modelmagnetotelluricgravityplay fairwaynatural statethermal modelingmagnetotelluricsplay fairway analysissrpmtgeophysicsgeophysicaltemperaurepre-productionstatestructureresource assessmentpfamodellingnatural

Utah FORGE: Phase 2C Topical Report

Dec 11, 2019
147.81 MB
Publicly accessible
This is the topical report that wraps up the work and results achieved during Utah FORGE Phase 2C. The zip file includes several folders containing (1) an overview; (2) the results; (3) the lessons learned; and (4) the conclusions. It also contains a folder containing appendices i...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeutah forge phase 2c reportphase 2c topical reportutah forge phase 2cegsmoderate rate injection testsmicroseismicdistributed acoustic sensingdasseismic reflection surveygravity measurementsinsarstimulatednumerical reservoir modelsalluvium-granitoidinjection testingmilfordroosevelt hot springsoverviewresultslessonslearnedconclusionspermittingcharacterizationsitedata inventoryconceptualgeologicmodelgeophysicsseismicgravitygeologyfeasibilitytechnicalinjection testmicroseismicityremote sensingmodelingstimulation

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

Snake River Plain Play Fairway Analysis: Phase 2 Report and Phase 3 Proposal

Sep 05, 2017
33.13 MB
Publicly accessible
This report presents the results of Phase 2 of the Snake River Plain Play Fairway Analysis project, and a summary of proposed work for Phase 3. Phase 2 focused on new data collection in specific areas of interest identified in Phase 1. These data include new magnetotelluric, seism...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainmountain homecamas prairiebostic-1thermal wellmagnetotelluricseismicgravitymagneticstructuralblindresourcecharacterizationidahogeologyar-arbasalticvolcanovolcanic rockwell datathermalgeophysicssrpmtpfamodelingbostichydrologicwaterchemistrysurvey

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

Newberry Caldera Conceptual Geophysical Model

Mar 04, 2016
Size unavailable
Publicly accessible
Conceptual model for the Newberry Caldera geothermal area. Model is centered around caldera and evaluates multiple geophysical datasets to derive a conceptual subsurface model. Includes: Conductor layer based on transient electromagnetic data from Fitterman et al., 1988 (figure...
Authors
Moser, M. et al National Energy Technology Laboratory
geothermalenhanced geothermal systemegsnewgennewberryoregongravityseismicconceptual modelsubsurface modelgeologic modelstructuregeophysicsfaultsmtmagnetotelluricmodelconceptualgeophysicalcaldera

USGS Geophysics, Heat Flow, and Slip and Dilation Tendency Data used in Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
Size unavailable
Publicly accessible
This package contains USGS data contributions to the DOE-funded Nevada Geothermal Machine Learning Project, with the objective of developing a machine learning approach to identifying new geothermal systems in the Great Basin. This package contains three major data products (geoph...
Authors
DeAngelo, J. et al Nevada Bureau of Mines and Geology
geothermalenergygeophisicsnevadaslipdilationheat flowgravitymagneticsfaultsgeotiffsmachine learningexplorationcharacterizationhydrothermalgreat basingeophysicspfa

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Exploring for Geothermal Resources in a Dormant Volcanic System: The Haleakala Southwest Rift Zone, Maui, Hawai'i

Dec 01, 2011
46.27 MB
Publicly accessible
Suites of new geophysical and geochemical surveys provide evidence for geothermal resource at the Haleakala Southwest Rift Zone (HSWRZ) on Maui Island, Hawai'i. This poster outlines the Site's background, the geophysical surveys conducted on the Site (LiDAR, gravity and magnetics)...
Authors
Martini, B. et al Ormat Nevada Inc
geothermalexplorationblind geothermal systemsmauihawaiivolcanicgeophysicalgeochemicaltimelinebudgetgravityco2 fluxsoil temperaturehyperspectralisotopeaeromagneticpunaulupalakuahaleakalarift zone

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Maui Gravity and Soil Gas Surveys

Apr 01, 2010
1.37 MB
Publicly accessible
Contains a ground-based gravity survey of South Maui and a series of soil CO2 flux and temperature surveys encompassing Maui and the Big Island. The gravity survey was collected from approximately 284 km2 and consisted of 400 gravity stations with 400 m spacing. Locations were de...
Authors
Akerley, J. Ormat Nevada Inc
geothermalgravitymauigeophysicsbouger anomalysoil fluxgeochemistrysoil gastemperaturehawaiibig island

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

West Flank Coso, CA Magnetic and Gravity Data

May 19, 2016
4.23 MB
Publicly accessible
Gravity and aeromagnetic data for West Flank FORGE site.
Authors
Katzenstein, A. et al Sandia National Laboratories
geothermalegsforgewest flankgravitymagneticaeromagneticgeophysicsgeophysical dataindian wells valleyeast-central californiacametamorphicstructuralaeromagcore complexcesium vapormagnetometercoso rangecoso

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data
<< Previous123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service