OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 91.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"groundwater monitoring"×
Seismic×

Utah FORGE 3-2535: Final Report on Joint Electromagnetic, Seismic, and InSAR Imaging of Fracture Growth During EGS Resource Development

May 30, 2025
2 MB
Curated
This dataset contains the final technical report for the project Joint Electromagnetic/Seismic/InSAR Imaging of Spatial-Temporal Fracture Growth and Estimation of Physical Fracture Properties During EGS Resource Development, carried out from 2021 to 2025 by Lawrence Berkeley Natio...
Authors
Alumbaugh, D. Lawrence Berkeley National Laboratory
geothermalenergyutah forgeegsseismicelectromageneticgeodeticdistributed fiber-optic sensingdata acquisitiondata processingdata interpretationtechnical reportinsarfracture growthfracture propertiesgeophysicsgeomechanics

Active Source Seismic (Ultrasonic) Data from Double-Direct Shear Lab Experiments

May 05, 2021
Size unavailable
Publicly accessible
Active source ultrasonic data from lab experiments p5270 and p5271 including raw waveforms (WF) and mechanical data (mat). From the PSU team working on the "Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties" project. The fric...
Authors
Marone, C. Pennsylvania State University
geothermalenergyseismicactive sourcelaboratoryfriction experimentultrasonicgeophysicsmicroseismicitylab dataraw datawaveformsmechanical datapreprocessedmatlabacousticsacousticbiaxial testing apparatusultrasonic acoustic monitoring systemmachine learningdeep learningaiartificial intelligenceseismic forecastingearthquake forecastingfault

Utah FORGE: Seismic Risk Trafic Light System Version 2

Jan 24, 2025
574.05 kB
Publicly accessible
The report outlines the updated Traffic Light System (TLS) for the Utah FORGE project, which aims to mitigate seismic risks associated with Enhanced Geothermal Systems (EGS) operations. It integrates lessons from past operations, including stimulation and circulation experiments a...
Authors
Pankow, K. et al University of Utah Seismograph Stations
geothermalenergyseismicseismic hazardstlstrafic light systemutah forgeseismic hazard mitigationwell stimulationegstraffic light systemseismic risk mitigationstimulationcirculationcape stationseismic thresholdsreal-time monitoringqseekreservoir dynamicsseismic eventsmagnitude thresholdsprotocols

Utah FORGE: GeoEnergie Suisse Microseismic Monitoring of 16A and 16B Circulation at Utah FORGE, August-September 2024

Jun 20, 2025
401.21 kB
Curated
This dataset contains microseismic event data collected by Geo-Energie Suisse during circulation testing of wells 16A(78)-32 and 16B(78)-32 at the Utah FORGE site in August and September 2024. The data were recorded using a local monitoring network and include key event parameters...
Authors
Dyer, B. et al Geo-Energy Suisse
geothermalenergyutah forgemicroseismicseismicmicroseismic datawell circulation16a-783216b-7832geo-energy suisseegscatalogevent catalogmagnitudepeak ground velocitysnrevent locationgeophysicsseismic clusteringdepthprocessed data

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Utah FORGE: 2024 Stimulations Microseismic Event Catalog from Seismic Surface Network

Jul 29, 2024
Size unavailable
Publicly accessible
This archive provides a a link to a microseismic event catalog of the 2024 stimulations at Utah FORGE. The catalog was derived from data collected with the surface monitoring network consisting of 5 permanent seismic stations deployed by the University of Utah Seismograph Station...
Authors
Niemz, P. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic dataseismicstimulationwell 16b78-32 stimulationseismicitystimulation seismic dataegs2024 stimulationcatalogmicroseismic event catalogevent catalogsurface monitoring networkgeophysicsmagnitude calibrationresearch articleprocessed datadata catalogseismograph stationshydraulic fracturingreservoir engineering

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Newberry EGS Literature References

Apr 22, 2016
69.94 kB
Publicly accessible
Research references to literature about the Newberry geothermal area, Oregon.
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengeophysicsgeologyhydrothermalseismicstructurep waveelectricmagnetotelluriclithologyliteraturefield guidegeologic historyvolcano hazardsframeworkpetrologyexploratory drillingslimholeexplorationflow testingdrillholestructuralactive sourceteleseismictomographyresource characterizationmagma chambercrustalvelocitygravityemelectricalcompressional wavecoremineralogy

Newberry EGS Well Logs, Earthquakes, Maps, Cross-Sections, and LiDAR Datasets

Apr 22, 2016
13.4 kB
Publicly accessible
Datasets and information used to characterize the subsurface of Newberry and support modeling efforts. Includes sources for well logs, earthquakes, maps & cross-sections, and LiDAR/DEM
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewgennewberryoregonearthquakesseismicgeologic maplidardemdatasetmodelwell logearthquakeseismicitymapcross-sectionremote sensing

Utah FORGE: Earthquake Information and Data

Feb 29, 2016
Size unavailable
Publicly accessible
This site contains information and data related to Utah earthquakes. It is maintained by the USGS Earthquake Hazards Program. This site contains information relevant to the Utah FORGE project.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah earthquakesearthquakesforgeutah forgeseismic eventsutah seismic eventsegsseismicityseismic monitoringseismologyutahearthquakedataeventroosevelt hot springsmilford

Brady 1D Seismic Velocity Model Ambient Noise Prelim

Oct 25, 2013
0.97 kB
Publicly accessible
Preliminary 1D seismic velocity model derived from ambient noise correlation. 28 Green's functions filtered between 4-10 Hz for Vp, Vs, and Qs were calculated. 1D model estimated for each path. The final model is a median of the individual models. Resolution is best for the top 1 ...
Authors
J., R. Lawrence Livermore National Laboratory
seismicvelocity modelbradysseismic velocitygeothermalnevada

Utah FORGE 3-2417: DAS-derived Moment Tensors from the 16A/16B Stimulation April, 2024

Aug 22, 2025
1.41 MB
Curated
This dataset contains a catalog of moment tensors derived from distributed acoustic sensing (DAS) data acquired during stimulation of Utah FORGE Well 16A, conducted between April 3 and April 7, 2024. The data were generated as part of the FOGMORE (Fiber Optic MOnitoring for Reserv...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicmoment tensorenhanced geothermalegsfogmoresilixa16a stimulationdistributed acoustic sensingfiber opticsseismic monitoringstimulationmicroseismicitycarinaidasseismic inversiongeophysicssubsurface characterizationseismic momentconfidence indexcondition numbermoment catalogprocessed data

Brady's Geothermal Field Reftek Seismometer Metadata

Mar 26, 2016
457.21 kB
Publicly accessible
Metadata for the Reftek seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatareftekseismometerseismicarraypassive seismicporotomobradygeophysicsmonitoringseismicity

Utah FORGE: Ground Motion Study Report

Mar 16, 2018
3.11 MB
Publicly accessible
Paragon Geophysical contracted Urban Seismic Specialists to conduct A Ground Motion Study, on their Forge 3D project located near in Milford Utah .The test was conducted to measure the effects of the vibrator array on a pipeline owned by Kern River. Testing began November 22nd, an...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyground motionseismicearthquakeutah forgeforgeseismicityparticle motionppvmonitoringtestingsweep testingvibrator arraypeak particle velocityutahegsstudygeophysicsdemobilizationdemobilizingvibratorroosevelt hot springsmilfordreport

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Brady's Geothermal Field Reftek Seismometer Data

Mar 30, 2016
Size unavailable
Publicly accessible
Continuous seismic recordings from six Reftek seismometers deployed at Bradys Hot Springs geothermal field in Nevada from March 9th to 30th, 2016. Data is archived in mseed format. Five of the six stations are under a moratorium.
Authors
Feigl, K. University of Wisconsin
geothermalporotomopassive seismicbradys hot springsnevadareftekseismometerseismicarraybradyseismicitymonitoringnvpassive source

Utah FORGE: Seismograph Station Information and Data

Jan 26, 2021
Size unavailable
Curated
This link leads to the University of Utah Seismograph Stations website Utah FORGE seismograph stations page. This page contains a location map and description of the Utah FORGE seismograph stations and other related information. Additionally, data can be downloaded for each statio...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalforgeutah forgewell 68-32 seismic datautah forge seismograph stationsuniversity of utah seismograph stationsutah seismograph stationsuniversity of utahegsmilfordutahroosevelt hot springsseismographstationsseismicboreholewebicordergeophysics

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Curated
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Utah FORGE: Site Earthquake Animation

Mar 13, 2016
1.14 MB
Publicly accessible
This is a .kml earthquake animation covering the period of 1991 2011 for the Utah Milford FORGE site. It displays seismic events using different sized bubbles according to magnitude. It covers the general Utah FORGE area (large shaded rectangle) with the final site displayed as a ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsearthquakesgeospatialsimulationseismologyarcgisgoogle earthseismicityseismic monitoringbackgroundutahgeospatial dataearthquakeanimationtime lapseeventmagnitude

Brady's Geothermal Field Nodal Seismometer Earthquake Data

Mar 21, 2016
95.92 MB
Publicly accessible
90-second records of data from 238 three-component nodal seismometer deployed at Bradys geothermal field. The time window catches an earthquake arrival. Earthquake data from USGS online catalog: Magnitude: 4.3 ml +/ 0.4 Location: 38.479 deg N 118.366 deg W +/ 0.7 km Depth: 9.9 km...
Authors
Feigl, K. University of Wisconsin
geothermalpassive seismicearthquakebrady geothermal fieldnevadaporotomoseismicmonitoringeqmicroseismicitymicroseismic3-componentnv

Triggered MEQ Events on LBNL Permanent Seismic Array, Brady's EGS, March 2016

Jun 01, 2016
83.98 kB
Publicly accessible
List of triggered events recorded on LBNL's permanent EGS seismic array at Brady's geothermal field. This submission also includes links to the NCEDC EGS Earthquake Catalog Search page and to the metadata for the seismic array installed at Brady's Geothermal Field.
Authors
Robertson, M. University of Wisconsin
geothermalporotomoegsseismic monitoringseismic networkseismicitymicroseismicityinduced seismicitymeqbradybradys geothermal fieldbradys hot springsearthquake catalogearthquakestimulationgeophysicsgeophysicalseismic

Pressure-Temperature Simulation at Brady Hot Springs

Jul 11, 2017
2.96 MB
Publicly accessible
These files contain the output of a model calculation to simulate the pressure and temperature of fluid at Brady Hot Springs, Nevada, USA. The calculation couples the hydrologic flow (Darcy's Law) with simple thermodynamics. The epoch of validity is 24 March 2015. Coordinates are ...
Authors
Feigl, K. Temple University
geothermalenergyinsar-meqporotomoinsarmicroseismicitymeqmicroearthquakeseismicityinducedsimulationpressuretemperaturebradybrady hot springs

Brady's Geothermal Field Map of DAS, Nodal, Vibroseis and Reftek Station Deployment

Oct 15, 2016
1.62 MB
Publicly accessible
Map of DAS, nodal, vibroseis and Reftek stations during March 2016 deployment. The plot on the left has nodal stations labeled; the plot on the right has vibroseis observations labeled. Stations are shown in map-view using Brady's rotated X-Y coordinates with side plots denoting...
Authors
Feigl, K. University of Wisconsin
geothermalmapdeploymentbrady geothermal fieldegsporotomoseismic stationsdasdistributed acoustic sensingnodalseismometervibroseisreftekstationsbradybradys hot springsactive sourcepassive sourcedetectionmonitoringseismicgeophysicsboreholesurfacearraydownholeobservation locations
<< Previous1234Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service