OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 83.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"carbonate geothermal system"×
Gravity×

Gravity Survey of the Carson Sink Data and Maps

Dec 31, 2013
715.03 MB
Publicly accessible
A detailed gravity survey was carried out for the entire Carson Sink in western Nevada (Figure 1) through a subcontract to Zonge Engineering, Inc. The Carson Sink is a large composite basin containing three known, blind high-temperature geothermal systems (Fallon Airbase, Stillwat...
Authors
E., J. University of Nevada
geothermalcarson sinkbasin and rangegravity studygravity modeldepth to basementnevadagreat basindepth to basmentfallon airbasestillwatersoda lakegravity surveygeophysicscomplete bouger anomalybouger anomalydatageospatial data

The Convergence of Heat, Groundwater, & Fracture Permeability: Innovative Play Fairway Modeling Applied to the Tularosa Basin Project Report

May 31, 2017
5.76 MB
Publicly accessible
This report details all of the work done in Phase 2 of a geothermal exploration project in Tularosa Basin, New Mexico. Data acquired as part of Phase 2 includes field geology (geological reconnaissance and mapping), gravity surveys, shallow temperature surveys, well water sampling...
Authors
Nash, G. et al Energy and Geoscience Institute at the University of Utah
geothermalenergytularosapermeabilityplay fairway analysisphase 2new mexicopfaexplorationfield geologyreconnaissancemappinggravityshallow temperature surveywell water samplinggroundwater samplingwater samplinggravity surveygeothermometryshallow temptemperature loggingtemperaturemtmagnetotelluricmt surveypriorityresource assessmentmodelgeophysics

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Hawaii Play Fairway Analysis: Gravity Model

Dec 15, 2015
4.49 MB
Publicly accessible
Gravity model for the state of Hawaii. Data is from the following source: Flinders, A.F., Ito, G., Garcia, M.O., Sinton, J.M., Kauahikaua, J.P., and Taylor, B., 2013, Intrusive dike complexes, cumulate cores, and the extrusive growth of Hawaiian volcanoes: Geophysical Research Let...
Authors
Lautze, N. University of Hawaii
geothermalgravityhawaiimodelgeophysicalgeophysicspfageospatial data

LiDAR as an Exploration Tool

Jan 01, 2011
4.36 MB
Publicly accessible
Using LiDAR to identify structural and volcanic evolution of a Miocene-Pleistocene age bimodal volcanic complex and implications for geothermal potential. The file includes an updated geologic map, methods, and preliminary results.
Authors
Boschmann, D. et al Ormat Nevada Inc
geothermalglass buttesoregonstructural modelgravitybougerdemmagnetotelluricaeromagneticcolumbia plateaulidarhyperspectralinversionlineamentexplorationgeologic mapgeology

2011 Glass Buttes Exploration and Drilling

Jan 01, 2011
1.27 MB
Publicly accessible
2011 Geothermal Technologies Program Peer Review Presentation summarizing relevance, proposed approach, and logistics of the Glass Buttes Exploration and Drilling.
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermalalterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidarhyperspectralgravitymineral assemblages3d geologic modelfield workexplorationdrilling

Conducting a 3D Converted Shear Wave Project to reduce exploration risk at Wister, CA: Geothermal Technologies Program 2011 Peer Review

Jun 01, 2011
1.35 MB
Publicly accessible
2011 Peer Review of the 'Conducting a 3D Converted Shear Wave' Project to reduce exploration risk at Wister, CA.
Authors
Matlick, S. Ormat Nevada Inc
geothermalwister caconverted shear wave3c 3d seismictemperature gradient holesgravitymagneticexplorationblind

Validation of Innovative Exploration Technologies for Newberry Volcano: Raw Gravity Data

Oct 11, 2010
265.07 kB
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Raw data used to prepare the Gravity Report by Zonge 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalgravitynewberryvolcanocalderainoovative exploration technologiesraw datageophysicsietexplorationrawdatahydrothermalegs

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Gravity, Granite Springs Valley, Nevada Play Fairway Analysis

Sep 14, 2017
979.85 kB
Publicly accessible
All raw data for new data acquired, key grids such as CBA and horizontal derivative, acquisition report, and depth models. This gravity data is associated with the Nevada Play Fairway project.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
gravitygranite springs valleygeophysicspfanevadanvmodelingacquisitiongridscbahorizontal derivativedepthmodelrawdatainvertedprofilesectioncorrectedfree airtidetidalreportdensity contrastgsvnv great basin

Validation of Innovative Exploration Technologies for Newberry Volcano: Gravity Report

Jan 06, 2012
4.75 MB
Publicly accessible
Report detailing data acquisition, quality, processing, and presentation for the gravity survey conducted on the Newberry Volcano. (Validation of Innovative Exploration Technologies for Newberry Volcano: Gravity Report of Newberry prepared by Zonge GeoSciences 2012)
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalgravitynewberryoregonvolcanocalderaexplorationinnovative exploration technologiesdeschutes countydata acquisitiongeophysicssurveyietreporthydrothermalegs

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Utah FORGE: Raw Microgravity Composite Data Updated 10/2021

Oct 01, 2021
7.98 kB
Publicly accessible
This is a microgravity dataset from the Utah FORGE site near Milford, Utah. This composite dataset was updated in October, 2021 and contains data from December 17th, 2018 through September 24th, 2021. The data includes the GPS location of the measurement, date of the measurement, ...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergygravity datamicrogravity datautah forgeutah forge microgravityutah forge gravityutah geothermalmigrogravitygravitydatageophysicsutahraw datagpsgravity station

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Gravity Data for West-Central Colorado

Apr 06, 2012
164.99 MB
Publicly accessible
Modeled Bouger-Corrected Gravity data was extracted from the Pan American Center for Earth and Environmental Studies Gravity Database of the U.S. at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was open...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalgravitybougercoloradoshapefilepoint shapefileline shapefileshape filegisarcgisgeospatialcontourwestcentralwest-centraldatageospatial data

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Snake River Plain Play Fairway Analysis: Phase 2 Report and Phase 3 Proposal

Sep 05, 2017
33.13 MB
Publicly accessible
This report presents the results of Phase 2 of the Snake River Plain Play Fairway Analysis project, and a summary of proposed work for Phase 3. Phase 2 focused on new data collection in specific areas of interest identified in Phase 1. These data include new magnetotelluric, seism...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainmountain homecamas prairiebostic-1thermal wellmagnetotelluricseismicgravitymagneticstructuralblindresourcecharacterizationidahogeologyar-arbasalticvolcanovolcanic rockwell datathermalgeophysicssrpmtpfamodelingbostichydrologicwaterchemistrysurvey

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Hot Pot: Complete Bouguer Gravity Map

Jun 28, 2013
88.7 kB
Publicly accessible
Contoured Bouguer gravity survey with lease block outline in 2010 and location of hot springs.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeophysicsgravity surveymetadatabouger anomalygravity mapmap packagegisgeospatial data

Fallon FORGE: Gravity and Magnetics Data

Mar 09, 2018
5.68 MB
Publicly accessible
This package contains principal facts for new gravity data collected September November 2017 in support of the Fallon FORGE project. Also included are rock core density and magnetic susceptibility data for key core intervals, used in modeling 2D and 3D gravity inversions. Indivi...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallongravitynevadadensitymagnetic susceptibilityvetted-nonvmagneticsbch-3foh-2sw51-20bunejug mountains3dinversiongeophysicsgravmagrock densityinverse modelgeospatial datadata

Conducting a 3D Converted Shear Wave Project to Reduce Exploration Risk at Wister, CA

May 18, 2010
2.61 MB
Publicly accessible
2010 Peer Review of the 'Conducting a 3D Converted Shear Wave' Project to reduce exploration risk at Wister, CA. The presentation includes a timeline, budget, barriers, and partners. The objective of the project is also explained in the presentation.
Authors
Matlick, S. Ormat Nevada Inc
geothermalwister caconverted shear wave3c 3d seismictemperature gradient holesgravitymagneticexplorationblindshear waverisk reduction
<< Previous1234Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service