OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 186.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"data reduction"×
Seismic×

Brady's Geothermal Field Reftek Seismometer Metadata

Mar 26, 2016
457.21 kB
Publicly accessible
Metadata for the Reftek seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatareftekseismometerseismicarraypassive seismicporotomobradygeophysicsmonitoringseismicity

Cape EGS: Frisco Pad Wells Flow Test Microseismic Data

Nov 06, 2024
136.79 GB
Awaiting release
This dataset contains microseismic data acquired during the Frisco pad flow test project led by Fervo Energy, conducted between July 17th Aug 12th 2024, near the Utah FORGE geothermal site. The microseismic data was collected from various Utah FORGE wells: via Distributed Acoustic...
Authors
Dadi, S. and Kanu, O. Fervo Energy
geothermalenergycape egsutah forgemicroseismicfriscodasdistributed acoustic sensing3cthree componentgeophone16bsta/ltasegyflow testegsmilfordutahmicroseismic eventevent detectiontestingdevelopmentreservoir engineering

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

GEISER Project The Geysers Seismic Broadband Data 2012 2013

Oct 31, 2018
Size unavailable
Publicly accessible
This link points to the Northern California Earthquake Data Center (NCEDC) to access The Geysers seismic broadband data. The two available data sets consist of continuous waveform data recorded at The Geysers from July 2012 to July 2013 and a processed catalog with earthquake info...
Authors
Gritto, R. Array Information Technology
geothermalenergyseismic broadband dataseismicmicroseismiccontinuousinducedseismicitymicroseismicitymonitoringeventnetworkegsgeyserscacaliforniaarrivalearthquakegeisergeothermal engineering integrating mitigation of induced seismicity in reservoirsmitigationreservoirsstimulationresourcedevelopmenthydraulic

Utah FORGE 3-2417: DAS Microseismic Event Catalog from April 2024 Stimulation

Jun 09, 2025
9.11 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog and 3D velocity model from DAS acquisition conducted during the 16A stimulations that took place between April 3rd and April 7th, 2024. The catalog consists of multiple CSV files, each named after the associated s...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalfogmoreevent catalogcatalogmicroseismic eventsilixadistributed acoustic sensingidas16astimulationprocessed datavelocity modeldelano

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

Fallon FORGE: Vs30m Seismic Velocity

Mar 12, 2018
3.53 MB
Publicly accessible
Time-averaged shear-wave velocity to 30 m depth about the Fallon, NV FORGE site.
Authors
Blankenship, D. and Kaven, J. Sandia National Laboratories
geothermalenergyforgeegsfallonseismicityvs30nevadashearwavevelocityvetted-nogeophysicsseismicnvs-wave

Utah FORGE: 2D and 3D Seismic Data

Mar 16, 2018
127.26 GB
Publicly accessible
This set of data contains raw and Initially-processed 2D and 3D seismic data from the Utah FORGE study area near Roosevelt Hot Springs. Reprocessed versions of these data can be accessed at the linked submission in the Resources section titled "Reprocessed Seismic Reflection Data....
Authors
Miller, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismicseismic datautahutah forgeforgeroosevelt hot springs3d seismic data2d seismic dataseg-ycorrelateduncorrelatedgeophysicsactive sourcerawprocesseddataraw dataprocessed datavelocityegsmilford

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Utah FORGE: Microseismic Events

Jul 08, 2019
262.54 kB
Publicly accessible
This archive contains Excel spreadsheets containing microseismic events detected in the study area during Utah FORGE Phase 2C. The Readme file included that describes the meaning of the abbreviations used as field headers in the spreadsheets. Additionally, there is a .dat (text) f...
Authors
Rutledge, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeutah forge phase 2cutahmicroseismic eventsegsfracturereservoirstimulationmicroseismicityseismicitystressmilfordinjectionfrature networkhypocentersspectralmicroearthquakesforgephase 2croosevelt hot springsprocessed data

WHOLESCALE: Microseismic Event Catalog for San Emidio, Nevada 2022

Apr 20, 2024
174.08 kB
Publicly accessible
This submission includes a high-precision seismic event catalog estimated from seismic data collected at San Emidio, Nevada from April to May 2022. The catalog lists the precise time, location, and magnitude of microseismic events recorded during this period. Both the seismic dat...
Authors
Guo, H. et al University of Wisconsin Madison
geothermalenergywholescaleseismicprocessed datamicroseismic event catalogcatalogarrivalssan emidioraw datauncertaintyarrival detectionalgorithmresttomographyboostrapmagnitudegeophysics

Seismic Survey 2016 Metadata at San Emidio, Nevada

Dec 05, 2016
54.86 MB
Publicly accessible
1301 Vertical Component seismic instruments were deployed at San Emidio Geothermal field in Nevada in December 2016. The first record starts at 2016-12-05T02:00:00.000000Z (UTC) and the last record ends at 2016-12-11T14:00:59.998000Z (UTC). Data are stored in individual files in o...
Authors
Lord, N. et al University of Wisconsin
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadareporttechnical specificationintrumentationspecsspecspecifications

Utah FORGE: Earthquake Information and Data

Feb 29, 2016
Size unavailable
Publicly accessible
This site contains information and data related to Utah earthquakes. It is maintained by the USGS Earthquake Hazards Program. This site contains information relevant to the Utah FORGE project.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah earthquakesearthquakesforgeutah forgeseismic eventsutah seismic eventsegsseismicityseismic monitoringseismologyutahearthquakedataeventroosevelt hot springsmilford

Processed Lab Data for Neural Network-Based Shear Stress Level Prediction

May 14, 2021
6.01 MB
Publicly accessible
Machine learning can be used to predict fault properties such as shear stress, friction, and time to failure using continuous records of fault zone acoustic emissions. The files are extracted features and labels from lab data (experiment p4679). The features are extracted with a n...
Authors
Marone, C. et al Pennsylvania State University
geothermalenergymatlabgeophysicsseismiccodeprocessed datamicroseismicityaiartificial intelligencedeep learningmachine learningacousticsacoustic emissionsseismic forcastingseismic predictionfaultfault propertiesshear stresstime to failureexperimentexperimental datalab databiaxial shear experimentbiaxial shear apparatusfriction

Utah FORGE: Triggered 3-Component Surface Nodal Seismic Waveforms from the April 2022 FOAL 1 Experiment

Jun 30, 2026
736.6 MB
Publicly accessible
This package contains triggered 3-component surface nodal seismic waveforms recorded during the FOAL 1 experiment, or FORGE Observation Array Linear #1, which occurred during the April 2022 hydraulic stimulation of well 16A(78)-32 at the Utah FORGE EGS site. This data was utilized...
Authors
Kim, J. et al Rice University
geothermalenergyegsutah forgeforgemicroseismichydraulic stimulationfoal 1forge observation array linear16a32-32april 2022microseismicityinduced seismicitypassive seismic monitoringsurface nodal array3-component seismic datasmartsolominiseedstationxmlevent catalogwell trajectoryfogmoregeophysicsseismic dataprocessed data

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

Utah FORGE 3-2535: Report on Geodetic Observations of Fracture Development During April 2024 Stimulations

Apr 28, 2025
1.29 MB
Publicly accessible
This report presents geodetic observations from the April 2024 stimulations at the Utah FORGE site, as part of LBNL FORGE Project 3-2535. It focuses on Distributed Strain Sensing (DSS) data from an optical fiber in well 16B, capturing localized strain linked to fracture propagatio...
Authors
Vasco, D. et al Lawrence Berkeley National Laboratory
geothermalenergyutah forgeegsdistributed strain sensingdssfiber-optic sensingmicroseismicityfracture stimulationgeodetic monitoringinsarsubsurface deformationhydraulic fracturingseismicityfracture modelingreservoir characterizationtechnical reportprocessed dataapril 2024stimulation

EGS Collab Experiment 1: Accelerometer orientations

Aug 19, 2020
608.24 kB
Publicly accessible
Document describing the methodology used to determine the accelerometers' three-component orientations at the first EGS Collab testbed using Continuous Active-Source Seismic Monitoring (CASSM) data and hodogram analysis. Original submission: gdr.openei.org/submissions/1166
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabmicroseismicsensor orientationaccelerometerorientationsurfsanford underground research facilityhydraulicfracturingexperimentstimulationmeso-scalemesoscalecrystalline rock3d sensorleadsouth dakotasta/lta triggering algorithmmicroseismicitypythongeospatial data3-ccassm datahodogram analysisprincipal component analysispcawellborewell datawell geometrybandpass filtercontinuous active-source seismic monitoringcassmthree-component

Brady Geodatabase for Geothermal Exploration Artificial Intelligence

Apr 27, 2021
179.02 GB
Publicly accessible
These files contain the geodatabases related to Brady's Geothermal Field. It includes all input and output files for the Geothermal Exploration Artificial Intelligence. Input and output files are sorted into three categories: raw data, pre-processed data, and analysis (post-proces...
Authors
Moraga, J. et al Colorado School of Mines
geothermalenergygeodatabasebrady hot springsbradyartificial intelligenceaibrady wellseismicremote sensinghyperspectralgeospatial databasedeep learningmachine learningexplorationsite detectiongeothermal site detectionanomaly detectionshort wavelength infraredswirsupport vector machinesvmland surface temperaturelstwellraw dataprocessed datanevadaarcgismodeldatabasehydrothermalgeophysicsradargisblindblind systemdeformationgeophysicalhyperspectral imagingconceptual modelfaultpreprocessedrastervectorfield datageospatial data

Salton Sea Geodatabase for Geothermal Exploration Artificial Intelligence

Apr 27, 2021
148.82 GB
Publicly accessible
These files contain the geodatabases related to Salton Sea Geothermal Field. It includes all input and output files used with the Geothermal Exploration Artificial Intelligence. Input and output files are sorted into three categories: raw data, pre-processed data, and analysis (po...
Authors
Moraga, J. et al Colorado School of Mines
geothermalenergygeodatabasesalton seaartificial intelligenceaideep learningmachine learningseismicremote sensinghyperspectralhyperspectral imaginggeospacial databaseexplorationsite detectiongeothermal site detectionanomaly detectionshort wavelength infraredswirsupport vector machinesvmland surface temperaturelstwellraw dataprocessed datacaliforniaarcgisgismodeldatabasehydrothermalgeophysicsradarblindblind systemdeformationgeophysicalconceptual model faultpreprocessedrastervectorfield datageospatial data

2D Seismic Profiles, Nevada Play Fairway Granite Springs Valley

Sep 14, 2017
154.59 MB
Publicly accessible
This data is associated with the Nevada Play Fairway project and contains 2D seismic profile data in cropped jpegs and tiffs, both interpreted and uninterpreted. Seismic data owned or controlled by Seismic Exchange, Inc.; interpretation is that of the University of Nevada, Reno.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergyseismic profilegranite springs valleypfaplay fairwaygeophysicsseismicinterpretationprofilegeophysicaldataimagingnevadanvactive sourcenv great basin

Passive Seismic Emission Tomography Results at San Emidio Nevada

Dec 01, 2016
66.54 MB
Publicly accessible
The utility of passive seismic emission tomography for mapping geothermal permeability has been tested at San Emidio in Nevada. The San Emidio study area overlaps a geothermal field in production since 1987 and another resource to the south of the production field. Passive seismic...
Authors
Warren, I. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalgeospatial dataexcelp-wave velocity modelpassive seismicp-waveprocessed dataseismicvelocityhydrothermalsan emidiogeophysicspsetcharacteriztion

Utah FORGE: Development of a Reservoir Seismic Velocity Model and Seismic Resolution Study

Apr 30, 2022
15.3 MB
Publicly accessible
This is data from and a final report on the development of a 3D velocity model for the larger FORGE area and on the seismic resolution in the stimulated fracture volume at the bottom of well 16A-32. The velocity model was developed using RMS velocities of the seismic reflection su...
Authors
Vasco, D. and Chan, C. Array Information Technology
geothermalenergyseismic velocity modelseismic resolution3d p-wave3d s-waveseismicraw dataprocessed datawell 16a-32utah forge

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data
<< Previous1234567Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service