OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 109.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"depth data"×
Drilling and Completion×

Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
97.37 MB
Publicly accessible
This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egsroosevelt hot springutah geothermal wellswell logsutah well logsutah geothermalgeothermal well logsroosevelt hot springswater analysiswater qualitygeochemistryflow samplewireline samplepressure surveytemperature surveysubsurfacehistorywell schematicsite mapwell locationscasing schematicwell completionbhtgradienthydrothermal alterationcompensated soniccompensated neutronformation densityporositylaterlogdual inductionelectromagneticelectro-magneticthickness toolfracture identificationmud logcaliperboreholedownholegeophysicssurveygeophysicalgeochemicalwell datautah52-21well logresourcecharacterizationmilford

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing

Utah FORGE: Well 14-2 Logs and Data from Roosevelt Hot Spring Area

Mar 03, 2016
96.02 MB
Publicly accessible
This is a compilation of logs and data from Well 14-2 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Data includes: flowmeter survey (1989), geochemistry (1977-1978, 1977-1983), injection test data (1979, 1982), and spinner surveys (19...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermal wellsutah well logswell logsgeothermal wellsgeothermal well logsutah egsgeophysicsdownholeboreholemud logspinner surveyinjection testgeochemistryflowmeter testsonicgammaporositytemperaturepressuresurveysubsurfaceinductioncalipercompensated neutronformation densityutahwell datawell log14-2resourcecharacterizationmilfordroosevelt hot springsflowmeterspinnergamma raycompensatedneutronformationdensityelectricsteam injection

Utah FORGE: Observation Well Data

Feb 22, 2018
3.92 MB
Publicly accessible
This archive contains temperature data for Roosevelt Hot Springs observation wells OH-1, OH-4, OH-5 and OH-7. There are also mud logs for OH-4. These are old datasets obtained from Rocky Mountain Power for use in the Utah FORGE project. Temperature data were collected in the 1970s...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergytemperature logsforgeutah forgeroosevelt hot springsblundel power plantmud logsroosevelt hot springs observation wellstemperature surveygeologic loglithology logwell logutahwelllogdataobservationtemperatureoh-4oh-1oh-5oh-7mud logwell dataresourcecharacterizationmilfordegs

Lost Circulation Materials in Geothermal Drilling: Thermal Degradation, Viscosity, Compression, and Flow Loop Tests

Feb 01, 2022
2.29 GB
Publicly accessible
This dataset provides a set of experimental data on the performance of lost circulation materials (LCMs) used in geothermal drilling operations. It includes results from four distinct tests: thermal degradation, viscosity measurements, compression tests, and high-temperature flow ...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergylost circulation materialslcmgeothermal drillingdrillingraw dataprocessed datamass loss measurementslost circulation managementdegradationthermal degradationdegradation patternrheologyfluiddrilliing fluidhigh temperatureflow testcompression testflow loop testsealingviscosity measurements

Utah FORGE: Well 82-33 Logs and Data, Roosevelt Hot Spring Area

Mar 03, 2016
74.2 MB
Publicly accessible
This is a compilation of logs and data from Well 82-33 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgeutah egsroosevelt hot springgeothermal well logswell logsutah well logsgeothermal wellsutah geothermal wellsroosevel hot springbottom hole pressurecasing schematiccleanoutsdirctional surveygeochemistrygeology loginjection cpaacitymorning reportsplan of operationsspinner surveyinjection testwater analysiswater chemistrycompensated soniccalipercement bondcollar logcompensated neutronformation densitydifferential temperaturegamma raymud loginductionpressure surveytemperature surveywell logwell data82-33utahresourcecharacterizationmilfordroosevelt hot springs

Microhole drilling technology utilizing a golden section search algorithm

Jun 23, 2021
812.35 MB
Publicly accessible
A fundamental issue in microhole drilling is that delivering high weight-on-bit (WOB), high torque rotational horsepower to a conventional drill bit does not scale down to the hole sizes necessary to realize the envisioned cost savings An optimization algorithm called a golden sec...
Authors
Su, J. et al Sandia National Laboratories
geothermalpercussive hammerweight-on-bitoptimizationmicroholesslimholesdrillingexplorationmonitoringtechnical assessmentfeasibilitywobgssgolden section searchalgorithmblue canyon domenew mexico tech energetic materials research and testing centersocorronew mexico

Utah FORGE: Well 78B-32 Core Sample Petrographic Analysis Data

Feb 21, 2023
753.95 MB
Publicly accessible
This dataset contains an overview of the petrographic, X-ray Diffraction and scanning electron microscopy analyses of core samples from Utah FORGE Well 78B-32 and related data as described in the .zip folder's Description below.
Authors
Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 78b-32petrographysemxrdwell 78b-32 semwell 78b-32 xrdscanning electron microscopyx-ray diffractionmicroscopygeologywell datadrillingprocessed datacore petrography

Utah FORGE: Well Acord 1-26 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
91.14 MB
Publicly accessible
This is a compilation of logs and data from Well Acord 1-26 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Logs include: mud log (45'-12645'), compensated densilog (1102'-7923', 7900'-12644'), neutron log (1102'-7923'), dual induction ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egswell logsutah well logsgeothermal wellsutah geothermal wellsroosevelt hot springsroosevelt hot springcement bondgamma rayneutronporositycompensated densilogstratigraphic reportstratigraphypetrographydual inductionacousticacoustilogdensitytemperature logdifferentialsamplegeothermcalipermud logdrillers logwater rightspermission to drilldrilling planbond documentsacordutahacord 1-26well logwell dataresourcecharacterizationmilfordtemperaturedensilogcompensatedcuttings

Utah FORGE: Well 16A(78)-32 Simplified Discrete Fracture Network Data

Jun 01, 2021
525.86 MB
Publicly accessible
The FORGE team is making these fracture models available to researchers wanting a set of natural fractures in the FORGE reservoir for use in their own modeling work. They have been used to predict stimulation distances during hydraulic stimulation at the open toe section of well 1...
Authors
Finnila, A. Golder Associates Inc.
geothermalenergyutah forgeforgeutah geothermalreservoirengineeringhydraulicfracturingegsdfndiscrete fracture networkwell 16a78-32utahenhanced geothermal systemengineered geothermal systemfracmanroosevelt hot springsroosevelt hot springs geothermal sitemilfordprocessed datacsvwelldrillingstimulationpressuremodelmodeling

Microhole Test Data

May 23, 2016
226.52 kB
Publicly accessible
Drilling results from the microhole project at the Sandia High Operating Temperature test facility. The project is seeking to help reduce the cost of exploration and monitoring of geothermal wells and formations by drilling smaller holes. The tests were part of a control algorith...
Authors
Su, J. Sandia National Laboratories
geothermaldrillingmicroholehammerspercussionhothigh operating temperaturesandia

West Flank Coso FORGE: Downhole Lithologic Data

Mar 01, 2016
116.22 kB
Publicly accessible
x,y,z downhole lithologic logs for the wells in and around the West Flank FORGE site based on a review of cuttings, core, and mud logs.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankcosoegsforgelithologymud loglithologicallogwell logdownholewelldatacalifornia

Validation of Innovative Exploration Technologies for Newberry Volcano: Drilling Summary

Jan 01, 2012
84.24 kB
Publicly accessible
Drilling summary from validation of innovative exploration technologies for Newberry Volcano, including depths, dates, and drilling statistics from 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermaldrilling datanewberryoregonvolcanocalderaexplorationinnovative exploration technologiesdrillingietsummarystatisticswelldatawell datatgwtgtemperature gradienthydrothermalegs

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Borehole Sensors and Well Trajectories (April 2022)

Dec 23, 2022
Size unavailable
Publicly accessible
This link leads to a webpage with spreadsheets containing seismic borehole sensor locations and well trajectories for wells 56-32, 58-32, 78-32, 78B-32. Each of the files at the provided link include meta data on relevant information.
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeseismic sensorsborehole sensorswell trajectorieswell 58-32well 56-32well 78-32well 78b-32well trajectorycharacterizationwell datasensor datawellboredrillingexcelforgeegs

GLADE Project: Well Log Files for GLADE East and GLADE West wells

Aug 27, 2026
449.57 MB
Publicly accessible
Files include Well Log information and raw data files for both GLADE East and GLADE West geothermal wells in the DJ Basin, Colorado. Data can be viewed with a PDF file viewer or log viewer capable of reading .LAS files. Log types included are Cement Bond Logs (CBL's), Mud Logs, a ...
Authors
Rhodes, R. OXY USA Inc.
geothermalenergywell datacoloradolog datadj basinlogstemperaturemud logswireline logcblcement bond logswell construction

Geothermal Exploration Cost and Time

Feb 13, 2013
14.89 kB
Publicly accessible
This paper describes the methodology used to define the baseline exploration suite of techniques (baseline), as well as the approach that was used to create the cost and time data set that populates the baseline. The resulting product, an online tool for measuring impact, and the ...
Authors
Jenne, S. National Renewable Energy Laboratory
geothermalcosttimeexplorationgeophysicsgeochemistrydrillingremote sensingeconomic

U.S. Geothermal Electricity Siting Regulation and Zoning Ordinances (2026)

Sep 21, 2026
38.41 MB
Curated
This is a collection of documented state and local ordinances governing utility-scale geothermal electricity projects throughout the United States. The data were compiled using the Infrastructure Continuous Ordinance Mapping for Planning and Siting Systems (INFRA-COMPASS) tool, wh...
Authors
Pullutasig, B. et al National Laboratory of the Rockies
geothermalenergypowerutilitywellexplorationdrillingnoisesetbackspermitssitinglocalcitationsaillmcompassinfra-compassmachine readableartificial intelligencewell drillingpower plantspower production

Utah FORGE: Milford Digitized Geophysical Logs from Acord 1

Mar 31, 2016
133.55 MB
Publicly accessible
This submission includes digitalized versions of the following: McCulloch Geothermal Corp Acord 1-26 Cover Letter McCulloch Geothermal Corp Acord 1-26 Drilling Plan McCulloch Geothermal Corp Acord 1-26 Bond Documents Division of Water Rights Permission to Drill Drillers Log Geot...
Authors
Jones, C. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsmilfordutahwell datawater rightsacordaccordlogwelldatageophysicsgeophysicalwell logacord 1digitizeddrilling plandrillers logmud logneutron logcompensated densilogbhc acoustilogtemperaturedifferential temperaturedual inductionfocused loggamma raydensilogreport of well drillerstratigraphystratigraphic reportphotographycuttingsresourcecharacterizationroosevelt hot springsdrilling

Chemical, Calcium Phosphate Cements for Geothermal Wells Corrosion Protection, Bond Strength and Matrix Self-Healing

Sep 26, 2017
704 kB
Publicly accessible
The data set shows performance of economical calcium phosphate cement (Fondu) blended with fly ash, class F (FAF) in carbon steel corrosion protection tests (corrosion rate, corrosion current and potential), bond and matrix strength, as well as matrix strength recovery after impos...
Authors
Sugama, T. Brookhaven National Laboratory
geothermalenergycarbon steel corrosioncorrosion rateself-healinghigh temperaturehigh temphigh-tempcasingexperimentwellboreintegritycorrosion protectioncomposite

Hawthorne Nevada Deep Direct-Use Feasibility Study References, Reports, Literature

Mar 29, 2018
189.25 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorneel capitandrillingwell datadrilling data

Testing LCM on a Large Scale for Geothermal Drilling Applications Using a Novel Experimental Setup

Apr 22, 2022
15.98 MB
Publicly accessible
Rheology data obtained from flow loop tests, performed using different lost circulation materials (LCM) to study their effect on fluid rheology and wellbore hydraulics. The sealing performance of different LCM was tested using different fracture sizes. Five academic papers / repor...
Authors
Mohamed, A. et al University of Oklahoma
geothermal drillinglost circulationsealing efficiencyrheologyhigh temperatureflow loop3d printingtemperaturecharacterizationdrilling fluid additivesshape memory polymergeothermal wellshpht challengesdrilling fluidwellbore hydraulicshole cleaningfluid stabilitysmart lcmht flow looplost circulation materialannular flowrheological propertiesgeothermalenergyviscosifierfiltration controlhphtgeochemistrywellboredrilling technologyexperimenttechnologyreportsgwmodeldrillingprocessed data

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

West Flank Coso FORGE: 83-11 Image and Mud Log Data

Jul 31, 2009
859.62 MB
Publicly accessible
CBIL and STAR image logs as pre-processed DLIS files, and mud log of well 83-11
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flank cosowell datacosomud logimage logwell logwest flankcaliforniadlisstarimagecbil83-11
<< Previous12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service