OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 76 - 100 of 1427.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"Tracer Injection and groundwater monitoring"×

Tularosa Basin Play Fairway Analysis: Groundwater, Heat Flow, Relief Map

Nov 15, 2015
263.37 MB
Publicly accessible
In this submission is the groundwater composite risk segment (CRS) used for play fairway analysis. Also included is a heat flow probability map, and a shaded relief map of the Tularosa Basin, NM.
Authors
Brandt, A. University of Utah
geothermaltularosabasingroundwatercrscomposite risk segmentshaded reliefprobabilityheatflowheatflowmapfort blissmcgregor rangenew mexiconewmexicoshadedreliefpfaplay fairway analysisshapefileshape filegisarcgisgeospatial data

Hawaii Play Fairway Analysis: MT and AMT Survey along the Saddle Road, Hawaii

Jan 01, 2009
Size unavailable
Publicly accessible
Pierce, H.A., and Thomas, D.M., 2009, Magnetotelluric and audiomagnetotelluric groundwater survey along the Humu'ula portion of Saddle Road near and around the Pohakuloa Training Area, Hawaii: U.S. Geological Survey Open-File Report 2009, 1135, 160 p.
Authors
Pierce, H. and Thomas, D. University of Hawaii
geothermalmagnetotelluricgeophysicalsurveyhawaiimtamtaudiomagnetotelluricgroundwatersaddle roadpohakuloa training areageophysicspfa

A Hydrogeochemical Analysis of Geothermal Resources in the State of Hawaii

May 01, 2018
9.39 MB
Publicly accessible
The University of Hawaii at Manoa conducted a Play Fairway Analysis of the state of geothermal potential for the islands. Phase I included the aggregation of all existing geologic, geophysical and geochemical data available. A probability model incorporating heat, fluid, and perme...
Authors
Tachera, D. University of Hawaii
geothermalenergyhydrogeochemicalgeochemicalhawaiipfaplay fairwaygeochemistrycharacterizationmodelingplay fairway analysisgroundwatertemperaturechloridemagnesiumratiosulfatechloridesilicaconcentrationsouthwest rift zonehaleakalamauipalawai basinlanai

Effective Elastic and Neutron Capture Cross Section Calculations Corresponding to Simulated Fluid Properties from CO2 Push-Pull Simulations

Mar 07, 2018
4.46 MB
Publicly accessible
The submission contains a .xls files consisting of 10 excel sheets, which contain combined list of pressure, saturation, salinity, temperature profiles from the simulation of CO2 push-pull using Brady reservoir model and the corresponding effective compressional and shear velocity...
Authors
Chugunov, N. and Altundas, B. Lawrence Berkeley National Laboratory
geothermalenergyco2carbon dioxidepush-pullactive seismicwell loggingegsneutron capturesnuparstimulationsensitivity analysischaracterizationfaultfracturefluidbrine

Utah FORGE: Groundwater Data

Jul 20, 2016
621.85 kB
Publicly accessible
This submission includes two modeled drawdown scenarios with new supply well locations, a total dissolved solids (TDS) concentration grid (raster dataset representing the spatial distribution of TDS), and an excel spreadsheet containing well data.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmilfordutahegsforgegroundwaterdrawdownwellsupplytdsconcentrationgeochemistrywellsconcentrationsmodelaquifertesttransducerdataflow ratescenariowater tablemodelledpredictedpotentialgeospatial dataarcgisgisshapefileshape fileutah forgelocationwell locationreservoirsupply wellroosevelt hot springsresourcecharacterizationwell data

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Tularosa Basin Play Fairway Analysis: Pleistocene Lake Otero

Nov 15, 2015
80.05 kB
Publicly accessible
This submission includes a geotiff of the geographic extent of Pleistocene Lake Otero; which was used as apart of the groundwater composite risk segment in a Tularosa Basin Play Fairway Analysis.
Authors
Brandt, A. University of Utah
geothermallake oteropleistocenetularosabasinfort blissmcgregor rangepfatularosa basingroundwatershapefileshape filegisgeospatial dataarcgisshorelineplay fairway analysis

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Innovative Play Fairway Modelling Applied to the Tularosa Basin Project Report

Oct 16, 2015
4.44 MB
Publicly accessible
This report describes all of the work done in Phase I of a geothermal exploration project in the Tularosa Basin, as well as an outline for Phase II work, and more.
Authors
Bennett, C. et al University of Utah
geothermalexplorationphase 1tularosabasinnew mexicopfaplay fairway analysismodellingprojectreportpapernmheatgroundwaterfracture permeabilityinnovativeinvestigationresourceassessmenttularosa basin

Hawaii Play Fairway Analysis: Lanai Daily Drilling Reports

Jul 05, 2019
452.14 kB
Publicly accessible
The Hawaii Play Fairway Project deepened an already existing water well in Palawai Basin, Lanai island. Lanai Well #10 was deepened from 427 m to ~1057 m, with nearly continuous rock core collected. Spanning the dates from May 13 to July 5, 2019, the daily drilling reports of Lana...
Authors
Thomas, D. and Lautze, N. University of Hawaii
geothermalenergylanaigroundwaterhawaiiwaterwellcore photosdrillingdrilling datadrilling logspalawai basindatareport

EGS-Collab Experiment 1: Time-lapse ERT Data and E4D Inversion Files for 10-24-2018 through 11-07-2018 Flow Test

Jul 30, 2021
368.16 MB
Publicly accessible
This data submission includes the raw time-lapse ERT (electrical resistivity tomography) monitoring data, flow system data, operator logs, E4D (https://e4d.pnnl.gov) inversion files, and metadata necessary to reproduce the 4D ERT inversion for the Oct. 24 through Nov. 7 2018 post-...
Authors
Johnson, T. Pacific Northwest National Laboratory
geothermalenergyimagingstressresistivitytomography4dinjectionelectricalertflow testraw datadatae4dinversionvideoegssouth dakota

University of Illinois Campus Deep Direct-Use Feasibility Study Chemistry of Formation Waters

Apr 23, 2018
Size unavailable
Publicly accessible
Studies of chemical composition of natural brines from rock formations in the Illinois Basin as part of the University of Illinois deep direct-use feasibility study.
Authors
Lin, Y. et al University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoisillinois basinbrineschemistryfluidgroundwateraquiferrechargepotable water

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

STRESSINVERSE Software for Stress Inversion

Oct 31, 2018
Size unavailable
Publicly accessible
The STRESSINVERSE code uses an iterative method to find the nodal planes most consistent with the stress field given fault frictional properties. STRESINVERSE inverts the strike, rake and dip from moment tensor solutions for the in-situ state of stress. The code iteratively solves...
Authors
Gritto, R. Array Information Technology
geothermalenergystress inversioninversionstressseismicanalysisstressinversejointfault orientationmatlabcodenumericalmomenttensorsoftwarepassivefaultfaultingearthquakeorientationgeophysicsgeophysicalmicroseismicityinducedseismicitystimulationegsinjectionfracturemonitoringhydraulicgeneration

Hawaii Play Fairway Analysis: Lanai Resistivity and Density 3D Inversion Models

Jun 01, 2020
42.2 MB
Publicly accessible
To prepare for its third phase, the Hawaii Play Fairway project conducted groundwater sampling and analyses in ten locations in the Hawaiian islands, magnetotelluric (MT) and gravity surveys, as well as calculations of 3D subsurface stress due to the weight of the rock underlying ...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaimagnetotelluricgravityhaleakalamauimauna keamtmasurveydatateststresssubsurfacevolcanoresistivitydensityfracture induced permeabilityegsenhanced geothermal systemresourcepotentialresource probabilityexploratory drilling

Production and Injection data for NV Binary facilities

Dec 24, 2013
988.81 kB
Publicly accessible
Excel files are provided with well production and injection data for binary facilities in Nevada. The files contain the data that reported montly to the Nevada Bureau of Mines and Geology (NBMG) by the facility operators. this data has been complied into Excel spreadsheets for eac...
Authors
Mines, G. Idaho National Laboratory
geothermalbinarywell production datawell injection datanevadabinary power plantsblue mountainempiresalt wellssoda lakesteamboatgalenastillwaterwabuskaproduction flowproduction temperatureinjection flownbmgsteamboat iisteamboat iiiburdette

Hawaii Play Fairway Analysis: Recharge Data for the Islands of Kauai, Lanai and Molokai, Hawaii

Jan 01, 2015
156.43 kB
Publicly accessible
This dataset compiles groundwater recharge data for the islands of Kauai, Lanai and Molokai derived from published studies. The dataset is provided as a geospatial shapefiles with associated attribute files and are for use within GIS software capable of handling shapefile formats....
Authors
Lautze, N. University of Hawaii
geothermalrechargehawaiilanaikauaimolokaiwatergroundwateraquiferwater supplywater tablehydrologywater budgetpfadatageospatial data

Utah FORGE: 16B(78)-32 RFS DSS Strain Change Rate and Selected FDIs During 16A(78)-32 Stimulation

Mar 02, 2025
2.11 MB
Publicly accessible
This dataset contains strain change rate versus depth data acquired using a Rayleigh frequency shift (RFS) distributed strain sensing (DSS) system during hydraulic stimulation of well 16A(78)-32 at the Utah FORGE site in April 2024. The data were collected from an optical fiber in...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergyutah forgeneubrexstrain frac logfiber opticsmicrostrainstraincumulative strain change ratestrain change16a78-3216b78-32egshydraulic stimulationfiber optic sensingstrain change raterfsdssrayleigh frequency shiftdepth profileprocessed datafrac loggeomechanicsfracture driven interactionsfdifrac hitsperforation clustercross-well strain monitoring

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

Low Temperature Geothermal Resource Assessment for Desalination in United States

Sep 30, 2016
1.6 MB
Publicly accessible
This data is a compilation of well observations from the Southern Methodist University (SMU) and Association of American State Geologists (AASG), location of identified low temperature geothermal systems from United States Geological Survey (USGS), and low temperature geothermal w...
Authors
Akar, S. and Turchi, C. National Renewable Energy Laboratory
geothermallow temperaturedesalinationboreholedirect-usemembrane distillationresource assessmentlow tempfresh water availabilitythermal energy desalinationeconomicslcohlevelized cost of heat

The Convergence of Heat, Groundwater, & Fracture Permeability: Innovative Play Fairway Modeling Applied to the Tularosa Basin Project Report

May 31, 2017
5.76 MB
Publicly accessible
This report details all of the work done in Phase 2 of a geothermal exploration project in Tularosa Basin, New Mexico. Data acquired as part of Phase 2 includes field geology (geological reconnaissance and mapping), gravity surveys, shallow temperature surveys, well water sampling...
Authors
Nash, G. et al Energy and Geoscience Institute at the University of Utah
geothermalenergytularosapermeabilityplay fairway analysisphase 2new mexicopfaexplorationfield geologyreconnaissancemappinggravityshallow temperature surveywell water samplinggroundwater samplingwater samplinggravity surveygeothermometryshallow temptemperature loggingtemperaturemtmagnetotelluricmt surveypriorityresource assessmentmodelgeophysics

Water chemistry data and calculations for Fracture Sustainability Tests

Sep 30, 2020
1.26 MB
Publicly accessible
Measured cation, anion, and silica are presented as well as calculations evaluating mass balance performed for 4 fracture sustainability tests under EGS conditions: Stripa granite, Metamudstone, Rhyolitic Ashflow Tuff, and Silicified Rhyolitic Tuff. Calculations of charge balance ...
Authors
Kneafsey, T. et al Lawrence Berkeley National Laboratory
geothermalenergyfracturewater chemistryexperimentgranitedesert peakbradyegsreservoirfracture sustainability teststriparhyolitic ashflowtuff cationsilicified rhyoliticmetamudstonecationanionsilicamass balancepermeabilityshear-inducedgroundwater chemistrygroundwatergeochemistrymetasedimenteffluent

Nevada Production and Injection Well Data for Facilities with Flash Steam Plants

Jan 01, 2009
881.6 kB
Publicly accessible
Files contain a summary of the production and injection data submitted by the geothermal operators to the Nevada Bureau of Mines and Geology over the period from 1985 thru 2009
Authors
Mines, G. Idaho National Laboratory
geothermalbeowaweproduction datainjection databrady hot springsdesert peakdixie valleysteamboat hillsproducitoninjection

EGS Collab Experiment 2: Co-Injection Sewer Camera Survey Videos

May 20, 2025
38.69 GB
Publicly accessible
On April 21, 2022, sewer camera surveys were conducted in boreholes TN and TL as part of Experiment 2 of the EGS Collab project. These surveys were performed during fluid injection into three zones in borehole TC to identify the depths of active fracture intersections. The goal wa...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergysewer camegs collabfractureflowegsfracture characterizationsewer camera surveyborehole videovideosdownhole imaginginjectionfracture inflowtntltcexperiment 2injection zones
<< Previous12345678Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service