OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 76 - 100 of 209.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"hybrid geothermal natural gas system"×
Seismic×

Penn State Lab Testing Fluid-Rock Interaction in Geothermal Reservoirs

Jan 01, 2018
5.53 GB
Publicly accessible
This project focused on assessment and discovery of fluid-rock interaction in geothermal reservoirs. We accomplished work in four main areas: 1) fracture formation and the relationship between fluid flow and shear failure, 2) assessment of fracture geometry and fluid permeability ...
Authors
Madara, B. et al Pennsylvania State University
geothermalenergylab testingfracture formationshear failurefluid flowfracture geometryfluid permeabilityacoustic measurementsinjectionseismicitytriaxial experimentsdynamic stressingreservoir permeabilityfracture flowpermeability evolutionacoustic fracture characterizationfrictional stabilitydynamic triggeringinjection induced seismicityinduced seismicityshear slipshear flowberea sandstonewesterly graniteegsacoustic emissionslab earthquakes

Brady's Geothermal Field Nodal Seismometer Earthquake Data

Mar 21, 2016
95.92 MB
Publicly accessible
90-second records of data from 238 three-component nodal seismometer deployed at Bradys geothermal field. The time window catches an earthquake arrival. Earthquake data from USGS online catalog: Magnitude: 4.3 ml +/ 0.4 Location: 38.479 deg N 118.366 deg W +/ 0.7 km Depth: 9.9 km...
Authors
Feigl, K. University of Wisconsin
geothermalpassive seismicearthquakebrady geothermal fieldnevadaporotomoseismicmonitoringeqmicroseismicitymicroseismic3-componentnv

Brady's Geothermal Field Active Source Seismic Survey MetaData

Mar 28, 2016
2.03 MB
Publicly accessible
Sweep parameters, source locations and trigger timing for the four Phases of active source seismic data acquisition.
Authors
Robertson, M. University of Wisconsin
geothermalbrady geothermalactive sourceegsvibroseisseismicsource locationtrigger timegeophysicsgeophysicalporotomo

Bradys Hot Springs Ambient Noise Correlation Functions (Initial Waveforms)

Jul 01, 2015
34.08 MB
Publicly accessible
These files are ambient noise correlation (ANC) functions calculated for 11 days of continuous seismic data recorded by the Lawrence Berkeley network in the Brady geothermal field. These are SAC formatted seismic waveforms. The stations included are BPB04, BPB05, BPB07, BPB08, BP...
Authors
Matzel, E. Lawrence Livermore National Laboratory
geothermalambient noise correlationseismicbrady geothermal fieldseismic waveformsambient noise brady geothermalbradybradys hot springsporotomoancfunctions

Fallon FORGE: Seismic Reflection Profiles

Jan 01, 2015
14.3 MB
Publicly accessible
Fourteen seismic reflection profiles and their interpretations for the southern Carson Sink within and proximal to the proposed Fallon FORGE site. Five profiles were provided by the Navy Geothermal Program Office and reprocessed by Optim Inc. Nine proflies were acquired from the S...
Authors
Blankenship, D. Sandia National Laboratories
geothermalseismic profilescarson sinkfallonnevadaforgeseismicreflectiongeophysicstracesfaultdepth convertedinterpretedcontactsnvinterprettedinterpretationsei

Active Source 3D Seismic Tomography of Brady Hot Springs Geothermal Field, Nevada

Aug 09, 2017
26.79 MB
Publicly accessible
We deployed a dense seismic array to image the shallow structure in the injection area of the Brady Hot Springs geothermal site in Nevada. The array was composed of 238 5 Hz, three-component nodal instruments and 8,700 m of distributed acoustic sensing (DAS) fiber-optic cable inst...
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadaseismic tomographyactive sourceporotomobrady geothermal fieldbradysshallowseismic imagingporoelastic tomography

2D Seismic Profiles, Nevada Play Fairway Granite Springs Valley

Sep 14, 2017
154.59 MB
Publicly accessible
This data is associated with the Nevada Play Fairway project and contains 2D seismic profile data in cropped jpegs and tiffs, both interpreted and uninterpreted. Seismic data owned or controlled by Seismic Exchange, Inc.; interpretation is that of the University of Nevada, Reno.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergyseismic profilegranite springs valleypfaplay fairwaygeophysicsseismicinterpretationprofilegeophysicaldataimagingnevadanvactive sourcenv great basin

Utah FORGE 5-2557: Role of Fluid and Temperature in Fracture Mechanics and Couples THMC Processes for Enhanced Geothermal Systems 2024 Annual Workshop Presentation

Aug 13, 2024
111.95 MB
Publicly accessible
This is a presentation on the Role of Fluid and Temperature in Fracture Mechanics and Couples THMC Processes for Enhanced Geothermal Systems by Purdue University, presented by Laura Pyrak-Nolte. This video slide presentation describes the development and validation of a macroscopi...
Authors
Pyrak-Nolte, L. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeperdue universityfalconthmcmacroscopicdeformationfrictionseismicaseismicchemical reactionsx-ray microscopefracturespresentationegsvideoannual workshop

Brady's Geothermal Field Reftek Seismometer Data

Mar 30, 2016
Size unavailable
Publicly accessible
Continuous seismic recordings from six Reftek seismometers deployed at Bradys Hot Springs geothermal field in Nevada from March 9th to 30th, 2016. Data is archived in mseed format. Five of the six stations are under a moratorium.
Authors
Feigl, K. University of Wisconsin
geothermalporotomopassive seismicbradys hot springsnevadareftekseismometerseismicarraybradyseismicitymonitoringnvpassive source

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

GEISER Project The Geysers Seismic Broadband Data 2012 2013

Oct 31, 2018
Size unavailable
Publicly accessible
This link points to the Northern California Earthquake Data Center (NCEDC) to access The Geysers seismic broadband data. The two available data sets consist of continuous waveform data recorded at The Geysers from July 2012 to July 2013 and a processed catalog with earthquake info...
Authors
Gritto, R. Array Information Technology
geothermalenergyseismic broadband dataseismicmicroseismiccontinuousinducedseismicitymicroseismicitymonitoringeventnetworkegsgeyserscacaliforniaarrivalearthquakegeisergeothermal engineering integrating mitigation of induced seismicity in reservoirsmitigationreservoirsstimulationresourcedevelopmenthydraulic

Soda Lake Geothermal: Raw 3D and 3C Seismic-Reflection Data from 2010 Survey

Sep 01, 2010
172.11 GB
Publicly accessible
This dataset contains seismic-reflection records created in 2010 around the Soda Lake geothermal field near Fallon, Nevada. The data was collected by the power plant operator at the time, Magma Energy (CYRQ Energy in 2024). This was a petroleum-industry-quality three-dimensional ...
Authors
N. Louie, J. et al University of Nevada Reno
geothermalenergysoda lake geothermalseismic dataraw data3dseismic reflectionseg-yfield logsproject reportssoda lakenevadavibroseisfallon3cshot recordsfield recordssurveyseismic surveymagmageophysics

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin

Brady's Geothermal Field Metadata for DTS and DAS Surveys

Mar 26, 2016
10.46 MB
Publicly accessible
Metadata for DTS and DAS datasets for both borehole 56-1 and trenched cables.
Authors
Coleman, T. University of Wisconsin
geothermaldtsdastemperatureseismicnevadaboreholemetadatatrenched56-1distributed temperature sensingdistributed acoustic sensingbhporotomogeophysics

Exploration Best Practices on OpenEI

Sep 20, 2013
63.84 kB
Publicly accessible
This is an electronic database detailing different types of, various phases of, best practices for, and cost and time associated with geothermal exploration techniques. The groups of exploration techniques included in the database are Data and Modeling Techniques, Downhole Techniq...
Authors
Young, K. National Renewable Energy Laboratory
geothermalexplorationgeophysicsopeneiremote sensingconceptual modelsexploration costsbest practicesloggingdrillinggeochemistryresistivity surveymt surveyelectromagnetic surveygravityseismicisotopelidarhyperspectralmultispectralswirflirinsarsarreflectionrefractonmagneticsdc resistivity2-m probewell loggingdatabase link

Utah FORGE: Leapfrog 3D Geologic Movie

May 18, 2018
Size unavailable
Publicly accessible
This is a 3D geological movie of the Utah FORGE area created with Leapfrog Geothermal 3D modelling software. The movie shows the Utah FORGE site, wells, seismic and lithologic cross-sections, and rock unit tops. This illustrates the thick crystalline granitoid EGS reservoir.
Authors
Podgorney, R. Energy and Geoscience Institute at the University of Utah
geothermalenergy3d geologyutah forgeutahroosevelt hot springsgeologic movieleapfrog movieforgeegsmodelgeologicleapfrogwellsseismiccross sectionformation topsgeologystructuralmodeling3dmoviemilfordreservoirgranitoidcrystalline

Utah FORGE 5-2419: Final Report and Presentation on Seismicity Permeability Relationships Probed via Nonlinear Acoustic Imaging

Sep 30, 2025
254.88 MB
Publicly accessible
This submission contains the final technical report and closeout presentation for Utah FORGE Project 5-2419, which investigates the coupled evolution of permeability and induced seismicity in enhanced geothermal systems using laboratory experiments, field observations, and nonline...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegspermeabilityinduced seismicitylaboratory experimentsfield observationsnonlinear acoustic imagingfault reactivationreservoir rockmicroearthquakestimulationphysics informed modelingmachine learningseismic momentstress statepermeability creationseismic hazardtechnical reportgeomechanicsgeophysicsmicroseismicity

Brady Geothermal 1D Seismic Velocity Model

Feb 17, 2015
90.17 kB
Publicly accessible
This submission contains an ASCII text file of seismic velocities derived from ambient noise cross-correlation used to create a model of seismic velocity as a 1-D function of depth in addition to a quarterly report describing the creation and use of the model. Model uses 28 Green'...
Authors
Matzel, E. Lawrence Livermore National Laboratory
geothermalseismic velocity modelinsarambient noisebrady geothermal seismic modelseismicseismic velocity1d

Brady's Geothermal Field Map of DAS, Nodal, Vibroseis and Reftek Station Deployment

Oct 15, 2016
1.62 MB
Publicly accessible
Map of DAS, nodal, vibroseis and Reftek stations during March 2016 deployment. The plot on the left has nodal stations labeled; the plot on the right has vibroseis observations labeled. Stations are shown in map-view using Brady's rotated X-Y coordinates with side plots denoting...
Authors
Feigl, K. University of Wisconsin
geothermalmapdeploymentbrady geothermal fieldegsporotomoseismic stationsdasdistributed acoustic sensingnodalseismometervibroseisreftekstationsbradybradys hot springsactive sourcepassive sourcedetectionmonitoringseismicgeophysicsboreholesurfacearraydownholeobservation locations

Microearthquake Studies at the Salton Sea Geothermal Field

Oct 01, 2013
409.48 kB
Publicly accessible
The objective of this project is to detect and locate microearthquakes to aid in the characterization of reservoir fracture networks. Accurate identification and mapping of the large numbers of microearthquakes induced in EGS is one technique that provides diagnostic information w...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalseismicityearthquakesmicroearthquakesinduced seismicityfractureseismologysalton sea

Utah FORGE 3-2417: DAS Microseismic Event and MT Catalog from the 16A/16B Circulation Test [Final, Relocated], 2023

May 19, 2025
1.34 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog from distributed acoustic sensing (DAS) acquisition conducted during the 16A-16B circulation tests that took place in July 2023. These results update the catalog presented in GDR 1613 (the preliminary catalog, lin...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalevent catalog16a16bcirculationcirculation testinversionseismic eventsevent detectionmtdistributed acoustic sensingprocessed datamicroseismic event catalogmeqfogmore

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Utah FORGE: Preliminary Monitoring, Analyses, and Impact Assessment

Feb 09, 2017
9.97 MB
Publicly accessible
Preliminary monitoring and analyses for the Utah FORGE Milford Site. Includes a report detailing the seismic monitoring goals and results, a detailed techno-economic infrastructure assessment with an analysis, a budget, schedules, and cost summaries, and a summary of environmental...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalutahforgeutah forgeseismicseismic monitoringroosevelt hot springsmilfordreporttechno-economic infrastructureschedulesutah geothermalbudgettechno-economicnepaenvironmental impactsenvironmentassessmentevironmentalgeophysicseconomictechnicalmonitoringinfrastructureschedulecosteaseismicity

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

West Flank Coso, CA FORGE Test Area

Nov 15, 2015
773.24 kB
Publicly accessible
A map with the Coso West Flank FORGE test area outlined, along with regional seismicity, the aeromagnetic data set and the area currently being utilized for the creation of the 3D model.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankforgegeographygeophysicscaliforniacososeismicityaeromagnetic
<< Previous12345678Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service