OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 65.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Full temperature fields"×
Drilling and Completion×

Fallon FORGE: Lithology Logs and Well 21-31 Drilling Data

Mar 11, 2018
128.85 MB
Publicly accessible
This submission includes lithology logs for all Fallon FORGE area wells; determined from core, cuttings, and thin section. Wells included are 84-31, 21-31, 82-36, FOH-3D, 62-36, 18-5, 88-24, 86-25, FOH-2, 14-36, 17-16, 34-33, 35A-11, 51A-20, 62-15, 72-7, 86-15, Carson_Strat_1_36-3...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyfallonforgeegsnevadalithologywellscorecuttingsdepth intervalsgeologyvetted-nodrill logwell loggeologic unitextentnvdrillingloggingmud reportdrilling parametersmud lossesdirectional drillingwireline logsfracturesmineralsmineralogytemperaturegasesgamma raygamma radiationself potentialspontaneous potentialresistivitynphole diametersphi21-31datawelllog

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Publicly accessible
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Devices Suitable for Sectional Isolation Along Both Cased and Open-hole Wellbores Large-scale Test Setup

Jan 31, 2023
5.25 MB
Publicly accessible
The main goal of this project is to develop an annular isolation system capable to withstand geothermal downhole conditions and mitigate the problems experienced by conventional packers in FORGE wells. This large-scale set-up report is about the system that has been constructed to...
Authors
Teodoriu, C. et al Welltec
geothermalenergywellborecasingdrillingtechnicalassessmentstimulationforgeegs

Western USA Assessment of High Value Materials in Geothermal Fluids and Produced Fluids Final Report

Mar 18, 2019
12.34 MB
Publicly accessible
This report documents the results of investigations dealing with the concentrations and availabilities of strategic, critical and valuable materials (SCVM) in produced waters from geothermal and hydrocarbon reservoirs (50-250 degrees C) in Idaho, Nevada, New Mexico, Oregon, and Ut...
Authors
Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergystrategic critical metalsproduced geothermal fluidsproduced hydrocarbon fluidswestern usanevadautahidahooregonnew mexicogeologyproduction fieldsfluidgeochemistrytrace elementsstable isotopeshelium isotopesrocksdrill cuttingscalcite scalesroosevelt hot springsdixie valleybeowawemineralogy-lithologymineralogylithologycritical elementsmineral depositsdrillingproducedwaterreservoirtrace elementmineraldepositgeologicalgeochemicalcoproducedscvmstrategiccritical and valuable materials

Devices Suitable for Sectional Isolation Along Both Cased and Open-hole Wellbores Pipe Preparation Report

Mar 31, 2023
3.14 MB
Publicly accessible
The main goal of this project is to develop an annular isolation system capable to withstand geothermal downhole conditions and mitigate the problems experienced by conventional packers in FORGE wells. This pipe preparation report is based on the test pipe that was procured and pr...
Authors
Teodoriu, C. et al Welltec
geothermalenergywellborecasingdrillingtechnicalassessmentstimulationforgeegs

Project Red: Well 34A-22 Casing Integrity, Trajectory, Cement Bond, and Mudlog Data 2022

Jul 30, 2025
11.23 MB
Awaiting release
This dataset contains borehole logging data acquired in March-July 2022 from Fervo Energy geothermal wells in the Blue Mountain Geothermal Field, Humboldt County, Nevada. The submission includes casing inspection and cement evaluation logs, directional and trajectory measurements,...
Authors
Dadi, S. et al Fervo Energy
geothermalenergygeothermal wellswell loggingborehole loggingblue mountain geothermal fieldhumboldt countynevadafervoschlumbergerhalliburtonhorizonbm 34a24-23-22bm 34a31-23-22blue mountain 34alascasing inspectioncement bondacoustic cement evaluationtrajectory logsdirectional logsmudloglogsraw dataprocessed data

Utah FORGE: Well 16A(78)-32 Logs

Mar 08, 2021
10.01 GB
Publicly accessible
This dataset contains all well logs from Utah FORGE well 16A(78)-32. This includes the mud log, Sanvean Technologies logs, and Schlumberger logs. Please see the file descriptions below for information about each log.
Authors
Gilmour, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32 drilling logsutah forgeforgewell 16a78-32 sanvean logswell 16a78-32 schlumberger logswell 16a78-32 mud logutah geothermalwell dataloggingmud logsanvean logsschlumberger logs16a78-32well logegssanveanschlumbergerlithologyfmiformation microimagerfullborewellborecorecharacterizationdrillgeologydrill ratemineralstemperaturerate of penetrationropdrill stem test

Lost Circulation Materials in Geothermal Drilling: Thermal Degradation, Viscosity, Compression, and Flow Loop Tests

Feb 01, 2022
2.29 GB
Publicly accessible
This dataset provides a set of experimental data on the performance of lost circulation materials (LCMs) used in geothermal drilling operations. It includes results from four distinct tests: thermal degradation, viscosity measurements, compression tests, and high-temperature flow ...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergylost circulation materialslcmgeothermal drillingdrillingraw dataprocessed datamass loss measurementslost circulation managementdegradationthermal degradationdegradation patternrheologyfluiddrilliing fluidhigh temperatureflow testcompression testflow loop testsealingviscosity measurements

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Cape EGS: Gold 6-IB: Mud Log, Mass Spectrometry, and Dipole Sonic-Derived Geomechanical Data

Apr 30, 2025
20.64 MB
Awaiting release
This dataset includes geological and geophysical well log data from the Gold 6-IB well at the Cape EGS site in Utah, collected between January and April 2025. The data span the full well depth from surface to total depth (15,054 feet) and encompass mud log information, mass spectr...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsgold 6-ibmud logmass spectrometrydipole sonicgeomechanicsutah forgeacoustic slownessporosityanisotropywell logsgas analysislaslithologyraw data

EGS Collab Experiment 2: Core Photographs and Descriptions

Aug 05, 2021
136.42 GB
Publicly accessible
This submission contains photographs of rock core collected from EGS Collab Experiment 2 (and 3) boreholes. Cores were generally photographed in about 1-foot sections using Nikon D3300 DSLR cameras from two angles about 90 degrees apart, wet and dry. Core photos are provided here ...
Authors
Kneafsey, T. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 24100 levelsanford underground research facilitycore photographscoredrillinggeologysurfpanoramic photographscore logsanomaly logs

Project Red: Monitoring Well 73-22 Geophysical and Mud Logging Data 2022

Jul 30, 2025
19.14 MB
Awaiting release
This dataset contains open-hole geophysical and mud logging measurements acquired in 2022 from Monitoring Well 73-22 in the Blue Mountain Geothermal Field, Humboldt County, Nevada. Data were collected by Baker Hughes, Baker Atlas, Horizon Well Logging, and other service providers ...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyblue mountainblue mountain geothermal fieldegsnevadahumboldt county73-22monitoring wellproject redgeothermal well logswell logsgeophysical loggingmud loggingacoustic slownesscompressional slownessshear slownessstoneley wavemonopole acousticdipole acousticazimuthal anistropygamma ray logresistivity logneutron porositydensity logcaliper logborehole conditionsbulk modulusshear modulusmechanical propertieslithologyalteration mineralsfracturesgas detectionlasraw dataprocessed datafervo

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

West Flank Coso FORGE: Well 74-2TCH Temperature, Pressure, Well History, Well Bore Schematic

May 13, 2016
58.79 MB
Publicly accessible
Temperature logs, pressure logs, directional survey, well history, well bore schematic, and other reports for well 74-2TCH at West Flank FORGE
Authors
Blankenship, D. Sandia National Laboratories
geothermalwelltemperature logforgeegsmud logdaily reportsdrill rigstatic surveywell completionsurvey plotssundry noticetemperature gradientpressure gradientthin sectionswell historywellbore schematicwell schematichistoryschematictemperaturepressure74-2tchlogcoso

Validation of Innovative Exploration Technologies for Newberry Volcano: Shallow Temperature Data

Jan 01, 2012
1.66 MB
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Temperature Readings from 7 wells drilled to date by SMU 2012
Authors
Frone, Z. et al Davenport Newberry Holdings, LLC
geothermaltempteraturenewberryvolcanooregoncalderainnovative exploration technologiestemperaturewellsdrillingietexplorationwellshallowhydrothermalegs

Utah FORGE: Observation Well Data

Feb 22, 2018
3.92 MB
Publicly accessible
This archive contains temperature data for Roosevelt Hot Springs observation wells OH-1, OH-4, OH-5 and OH-7. There are also mud logs for OH-4. These are old datasets obtained from Rocky Mountain Power for use in the Utah FORGE project. Temperature data were collected in the 1970s...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergytemperature logsforgeutah forgeroosevelt hot springsblundel power plantmud logsroosevelt hot springs observation wellstemperature surveygeologic loglithology logwell logutahwelllogdataobservationtemperatureoh-4oh-1oh-5oh-7mud logwell dataresourcecharacterizationmilfordegs

West Flank Coso FORGE: Well 48-11TCH Temperature, Pressure, Directional, Well History, Wellbore Schematic

May 13, 2016
41.29 MB
Publicly accessible
Temperature logs, pressure logs, directional survey, well history, well bore schematic, and other reports for well 48-11TCH at West Flank FORGE
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgewell datatemperature logsmud logswest flankdaily drilling reportswell loghydrothermal veinshydrothermal clay abundanceresistivitylithologybreccia zonesdirectional surveystatic surveywell historywellbore schematicwell schematicbottomholegeothermal exploration permitsundry noticegradientservice reportloggingwell completionwellborecosotemperaturepressuredirectionalwellhistoryschematic48-11tchdata

Utah FORGE: Milford Digitized Geophysical Logs from Acord 1

Mar 31, 2016
133.55 MB
Publicly accessible
This submission includes digitalized versions of the following: McCulloch Geothermal Corp Acord 1-26 Cover Letter McCulloch Geothermal Corp Acord 1-26 Drilling Plan McCulloch Geothermal Corp Acord 1-26 Bond Documents Division of Water Rights Permission to Drill Drillers Log Geot...
Authors
Jones, C. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsmilfordutahwell datawater rightsacordaccordlogwelldatageophysicsgeophysicalwell logacord 1digitizeddrilling plandrillers logmud logneutron logcompensated densilogbhc acoustilogtemperaturedifferential temperaturedual inductionfocused loggamma raydensilogreport of well drillerstratigraphystratigraphic reportphotographycuttingsresourcecharacterizationroosevelt hot springsdrilling

Data of High-Temperature Dynamic LCM Testing Setup

May 31, 2021
9.94 MB
Publicly accessible
Data from high temperature dynamic sealing tests for various fracture widths, at various temperatures (degrees F), with 5 wt.% bentonite-based mud containing various material fiber contents, at 100 to 400 psi differential pressure. Data from pressure test and evaluation of the dy...
Authors
Magzoub, M. et al University of Oklahoma
geothermal drillinglost circulationshape memory polymergranitefractureswellbore strengtheningsealabilitygeothermalenergylost circulation materialssealing pressurefiltrationsmart lcmsmpfracture sealingdrilling fluid additivestemperaturemodeldrillingwellboreexperimenttechnologyprocessed data

Guelph, ON Canada DTS Metadata

Dec 15, 2014
290.13 kB
Publicly accessible
Metadata for active distributed temperature survey (DTS) experiments at Guelph, Ontario Canada. This data that this metadata refers to was taken as part of the PoroTomo project. The metadata includes information about status, location, elevation, units, and other metadata.
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperaturemetadatadistributed temperature surveyporotomodistributed temperature sensingcaoncanadaontarioguelphlocationelevationwelldrillingdepth

FedGeo Project: Low-Temperature Geothermal Resources at the U.S. Army Detroit Arsenal, Warren, Michigan

Sep 29, 2026
102.51 MB
In progress
This collection includes datasets used for the analyses and modeling of low-temperature geothermal resources at the U.S. Army's Detroit Arsenal located in Warren, Michigan. This project file includes tabular and geospatial data accessed from publicly available repositories held by...
Authors
University of Illinois Urbana-Champaign
geothermalenergydetroit arsenalmichiganmodelinggeophysicsdrillingfedgeogeologyhydrogeologylow temperature

High-Pressure and High-Temperature (HPHT) Lost Circulation Material (LCM) Testing

Nov 30, 2021
7.92 MB
Publicly accessible
High-pressure and high-temperature (HPHT) lost circulation material (LCM) rheology test results, LCM particle size distributions (PSD) analysis, and HPHT LCM fluid loss test results. Three academic papers / reports derived from this research are also presented.
Authors
Salehi, S. and Vivas, C. University of Oklahoma
geothermalenergylost circulation materialshpht filtrationfracture sealingparticle size distributionrheologydrilling fluid additivesgelationthermal degradationhigh pressure high temperaturepsdtemperaturemodeldrillingwellboreexperimenttechnologyprocessed datalcm
123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service