OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 63.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Utah Geological Survey maps"×
Gravity×

Utah FORGE: UGS Interactive Geoscience Map

Jan 01, 2021
Size unavailable
Publicly accessible
This is a link to the Utah Geological Survey's Utah FORGE Interactive Geoscience Map. The map layers include information on geology, geography, subsurface temperatures, seismicity, gravity and groundwater. Instructions for using the interactive map and a legend for the interactive...
Authors
Hill, J. Utah Geological Survey
geothermalenergyutah forgeinteractive mapgeology mapgravity maptemperature mapseismicity mapgroundwater mapugs mapsutah geological survey mapsutah forge mapsmapgeologyseismiclstgroundwaterhydrologyugsutahforgeinteractivegravityprocessed datageospatial datawater table depthgroundwater chemistrywellfaultwell temperaturetemperaturebedrockbedrock surfacebeddingfoliationcontactgeographycharcterizationegsmilfordroosevelt hot springsenhance geothermal systemengineered geothermal system

Utah FORGE: Raw Microgravity Composite Data Updated 10/2021

Oct 01, 2021
7.98 kB
Publicly accessible
This is a microgravity dataset from the Utah FORGE site near Milford, Utah. This composite dataset was updated in October, 2021 and contains data from December 17th, 2018 through September 24th, 2021. The data includes the GPS location of the measurement, date of the measurement, ...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergygravity datamicrogravity datautah forgeutah forge microgravityutah forge gravityutah geothermalmigrogravitygravitydatageophysicsutahraw datagpsgravity station

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Utah FORGE: Composite Raw Gravity Data 2021

Jun 04, 2021
7.3 kB
Publicly accessible
This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in me...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeutah forge gravity 2021forge gravity 2021gravity dataraw gravity dataraw datadatautahforgegravitygeophysicsgeophysicalgravimeter

Utah FORGE: Phase 2C Topical Report

Dec 11, 2019
147.81 MB
Publicly accessible
This is the topical report that wraps up the work and results achieved during Utah FORGE Phase 2C. The zip file includes several folders containing (1) an overview; (2) the results; (3) the lessons learned; and (4) the conclusions. It also contains a folder containing appendices i...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeutah forge phase 2c reportphase 2c topical reportutah forge phase 2cegsmoderate rate injection testsmicroseismicdistributed acoustic sensingdasseismic reflection surveygravity measurementsinsarstimulatednumerical reservoir modelsalluvium-granitoidinjection testingmilfordroosevelt hot springsoverviewresultslessonslearnedconclusionspermittingcharacterizationsitedata inventoryconceptualgeologicmodelgeophysicsseismicgravitygeologyfeasibilitytechnicalinjection testmicroseismicityremote sensingmodelingstimulation

Eastern Great Basin Geothermal Play Fairway Analysis Report

Jun 01, 2017
111.23 MB
Publicly accessible
This is the final report for the second phase of geological, geophysical, and geochemical data collection and processing for the Eastern Great Basin Geothermal Play Fairway Analysis project.
Authors
Wannamaker, P. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutahplay fairway analysisplay fairwaygreat basineastern great basinfinal reportpfaresourceidentificationexplorationwesternutregionextensionvolcanismheatpermeabilityflowboreholemtmagnetotelluricsresistivityanomalygeochemistryfluidgasvolcaniceruptionfaultstresscriticallyseismicitygravitygeophysicsgeologictwin peaksrhyolite fieldseismicpassivenodalmappingheliumsurveyheprobability krigingcrater knolldrill holesitingcomposite riskphase 2geology

The Convergence of Heat, Groundwater, & Fracture Permeability: Innovative Play Fairway Modeling Applied to the Tularosa Basin Project Report

May 31, 2017
5.76 MB
Publicly accessible
This report details all of the work done in Phase 2 of a geothermal exploration project in Tularosa Basin, New Mexico. Data acquired as part of Phase 2 includes field geology (geological reconnaissance and mapping), gravity surveys, shallow temperature surveys, well water sampling...
Authors
Nash, G. et al Energy and Geoscience Institute at the University of Utah
geothermalenergytularosapermeabilityplay fairway analysisphase 2new mexicopfaexplorationfield geologyreconnaissancemappinggravityshallow temperature surveywell water samplinggroundwater samplingwater samplinggravity surveygeothermometryshallow temptemperature loggingtemperaturemtmagnetotelluricmt surveypriorityresource assessmentmodelgeophysics

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Hawaii Play Fairway Analysis: Lanai Resistivity and Density 3D Inversion Models

Jun 01, 2020
42.2 MB
Publicly accessible
To prepare for its third phase, the Hawaii Play Fairway project conducted groundwater sampling and analyses in ten locations in the Hawaiian islands, magnetotelluric (MT) and gravity surveys, as well as calculations of 3D subsurface stress due to the weight of the rock underlying ...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaimagnetotelluricgravityhaleakalamauimauna keamtmasurveydatateststresssubsurfacevolcanoresistivitydensityfracture induced permeabilityegsenhanced geothermal systemresourcepotentialresource probabilityexploratory drilling

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Maui Gravity and Soil Gas Surveys

Apr 01, 2010
1.37 MB
Publicly accessible
Contains a ground-based gravity survey of South Maui and a series of soil CO2 flux and temperature surveys encompassing Maui and the Big Island. The gravity survey was collected from approximately 284 km2 and consisted of 400 gravity stations with 400 m spacing. Locations were de...
Authors
Akerley, J. Ormat Nevada Inc
geothermalgravitymauigeophysicsbouger anomalysoil fluxgeochemistrysoil gastemperaturehawaiibig island

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Publicly accessible
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Gravity Survey of the Carson Sink Data and Maps

Dec 31, 2013
715.03 MB
Publicly accessible
A detailed gravity survey was carried out for the entire Carson Sink in western Nevada (Figure 1) through a subcontract to Zonge Engineering, Inc. The Carson Sink is a large composite basin containing three known, blind high-temperature geothermal systems (Fallon Airbase, Stillwat...
Authors
E., J. University of Nevada
geothermalcarson sinkbasin and rangegravity studygravity modeldepth to basementnevadagreat basindepth to basmentfallon airbasestillwatersoda lakegravity surveygeophysicscomplete bouger anomalybouger anomalydatageospatial data

Washington Geothermal Play Fairway Analysis Data From Potential Field Studies

Dec 20, 2017
277.52 MB
Publicly accessible
A recent study which adapts play fairway analysis (PFA) methodology to assess geothermal potential was conducted at three locations (Mount Baker, Mount St. Helens seismic zone, and Wind River valley) along the Washington Cascade Range (Forson et al. 2017). Potential field (gravity...
Authors
Anderson, M. et al Washington Geological Survey
geothermalenergygravitymagneticspotential fieldsplay fairwaywashingtonland useprocess watertransmissionurban areaswatershapefilearcgisgeospatial datagissite assessmentsite characterizationgeophysicsgeophysicalsurveyexplorationinvestigationpfawashington state

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Alum Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
252.81 MB
Publicly accessible
Data generated from the Alum Innovative Exploration Project, one of several promising geothermal properties located in the middle to upper Miocene (~11-5 Ma, or million years BP) Silver Peak-Lone Mountain metamorphic core complex (SPCC) of the Walker Lane structural belt in Esmera...
Authors
Miller, C. Ram Power, Inc.
geothermalgravitymagneticsmtgeochemistryregional temperatureresource modelwell datageologyupper miocenesilver peaklone mountainwalker lanealumesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countygrav-magmagnetic3dprofileprofilesround 12009round 22010magnetotelluricsinversion30 ohm100 ohm300 ohmztemchemistrygeothermometrytemperaturehole 56-29historicshallowwell logsmoderngeologicgeomechanicsgeophysical25-2926-19geologyreportexecutive summarymapssectionsphotosphotographspicturesgeospatial data

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

Utah FORGE: 3D Gravity Data

Jun 24, 2019
11.24 MB
Publicly accessible
These resources describe the 3D geophysical inversion modeling of gravity data at the FORGE site near Milford, Utah. FORGE is the Frontier Observatory for Research in Geothermal Energy and the site in Utah has been selected by the U.S. Dept. of Energy for a 5-year R&D program to t...
Authors
Hardwick, C. and Witter, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge3d gravity datagravity datautah forge gravity datautah geothermalcomplete bouguerdensity modelgravityterrestrial gravity surveyobserved gravityforgegeophysics3d3d model3d gravitygravity anomalyegsmilfordinversionmodellinginverseroosevelt hot springsbougertop of granitedensitysurveysimple bougerfree airterrain correctiongeologiccorrectioncorrectedutahmodelmodeling

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford
123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service