OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 23 of 23.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"digital elevation map"×
Stimulation and Microseismicity×

Utah FORGE: Well 16A(78)-32 2022 Stimulation Microseismic Report

Sep 26, 2022
18.94 MB
Publicly accessible
This is a Utah FORGE well 16A(78)-32 stimulation microseismic detection and event location report from Silixa LLC. The report covers the digital acoustic sensing (DAS) data acquisition and analysis used to study microseismic events during the April, 2022 stimulations at well 16A(7...
Authors
LLC, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 16a78-32well 16amicroseismicitywell 16a78-32 stimulationwell 16a78-32 microseismicitywell stimulationsilixasilixa reportseismic monitoringmonitoringstimulationegsforgereportdetectionlocationeventgeophysicsdigital acoustic sensingdas

Cape EGS: Frisco 2-P Well Stimulation Microseismic Data

Sep 19, 2024
365.88 GB
Awaiting release
This dataset contains microseismic data acquired during the Frisco 2-P well stimulation project led by Fervo Energy, conducted between June 1 and June 11, 2024, near the Utah FORGE geothermal site. The microseismic data was collected from various Utah FORGE wells: via Distributed ...
Authors
Dadi, S. and Titov, A. Fervo Energy
geothermalenergymicroseismicdasgeophonefrisco 2-pcapeegs16b16adistributed acoustic sensing3cfervofriscoevent detectionstimulationgeophysicssta/ltaraw datafiber optic sensingdistributedutah forgetriggered eventdevelopmentmonitoringsegymilford

Cape EGS: Frisco Pad Wells Flow Test Microseismic Data

Nov 06, 2024
136.79 GB
Awaiting release
This dataset contains microseismic data acquired during the Frisco pad flow test project led by Fervo Energy, conducted between July 17th Aug 12th 2024, near the Utah FORGE geothermal site. The microseismic data was collected from various Utah FORGE wells: via Distributed Acoustic...
Authors
Dadi, S. and Kanu, O. Fervo Energy
geothermalenergycape egsutah forgemicroseismicfriscodasdistributed acoustic sensing3cthree componentgeophone16bsta/ltasegyflow testegsmilfordutahmicroseismic eventevent detectiontestingdevelopmentreservoir engineering

EGS Collab Experiment 2: Continuous Broadband Seismic Waveform Data

Sep 12, 2022
17.77 MB
Publicly accessible
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. This dataset includes the NSF SAGE website where seismic waveform data from this experiment can be downloaded. Two broadband seismometers were installed...
Authors
Rodriguez Tribaldos, V. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegswaveformsbroadbandtiltcharacterizationseismicwaveformgeophysicsexperiment 2continuousmonitoring4100 level

Pressure-Temperature Simulation at Brady Hot Springs

Jul 11, 2017
2.96 MB
Publicly accessible
These files contain the output of a model calculation to simulate the pressure and temperature of fluid at Brady Hot Springs, Nevada, USA. The calculation couples the hydrologic flow (Darcy's Law) with simple thermodynamics. The epoch of validity is 24 March 2015. Coordinates are ...
Authors
Feigl, K. Temple University
geothermalenergyinsar-meqporotomoinsarmicroseismicitymeqmicroearthquakeseismicityinducedsimulationpressuretemperaturebradybrady hot springs

EGS Collab Experiment 2: Laser Scanned 4100 L Drift Map

Dec 19, 2019
1.26 GB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergylaser scanned drift mapsurfegs collabhydraulic shearingsanford underground research facilityhydraulic fracturingegslaser scanneddrift mapyates shaftbattery charging stationlaser surveytestbed 2experiment 2autocadleapfrogpoint cloudmapremote sensing

Utah FORGE 3-2417: Simulations for Distributed Acoustic Sensing Strain Signatures as an Indicator of Fracture Connectivity

Jan 01, 2023
21.99 MB
Publicly accessible
This dataset encompasses simulations of strain signatures from both hydraulically connected and "near-miss" fractures in enhanced geothermal systems (EGS). The files and results are presented from the perspective of digital acoustic sensing's (DAS) potential to differentiate the t...
Authors
Ward-Baranyay, M. et al Rice University
geothermalenergyforgeutah forgeegsmilfordutahcomsoldfnmatlabsimulationnear-miss fracturedasdistributed acoustic sensingmodelingstrainfogmoregeophysicshydrogeomechanicssub-nanostraincodestimulation

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Utah FORGE: Neubrex Well 16B(78)-32 DAS Data April 2024

Oct 01, 2024
97.48 TB
Publicly accessible
This dataset comprises Distributed Acoustic Sensing (DAS) data collected from the Utah FORGE monitoring well 16B(78)-32 (the producer well) during hydraulic fracture stimulation operations conducted in April 2024. The data were acquired continuously over the stimulation period at ...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergydasacoustic sensingmicroseismiccrosswell strain ratefracture driven interactionsfdidistributed acoustic sensinginjection allocationstrain rateutah forgeegsstimulation16b 78-3216a 78-32mircroseismicityneubrexraw datahdf5h5time gated

kISMET Core Photos and Descriptions

Aug 02, 2016
15.5 GB
Publicly accessible
These core photos and descriptions were taken from the five boreholes that were drilled as part of the kISMET SubTER project conducted at the Sanford Underground Research Facility (SURF) in Lead, SD. The boreholes are subvertical in orientation, and were drilled on the 4850 level ...
Authors
Dobson, P. et al Lawrence Berkeley National Laboratory
geothermalsubterstresshydraulic fracturingegssanford underground research facilitycorepoorman formationsurfkismetcore logscore photoscore descriptionsborehole

Hybrid machine learning model to predict 3D in-situ permeability evolution

Nov 22, 2022
5.58 MB
Publicly accessible
Enhanced geothermal systems (EGS) can provide a sustainable and renewable solution to the new energy transition. Its potential relies on the ability to create a reservoir and to accurately evaluate its evolving hydraulic properties to predict fluid flow and estimate ultimate therm...
Authors
Elsworth, D. and Marone, C. Pennsylvania State University
geothermalenergyegsnewberryhydraulicstimulationprocessed datamachine learningpermeability evolutionhydraulic fracturinginduced seismicityegs collabseismic data analysiswellhead pressureflow ratefracture permeabilitymicroearthquakeenhanced geothermal systems

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Utah FORGE 3-2418: Wellbore Fracture Imaging Using Inflow Detection 2024 Annual Workshop Presentation

Sep 13, 2024
69.4 MB
Publicly accessible
This is a presentation on the Wellbore Fracture Imaging Using Inflow Detection by Stanford University and Sandia National Laboratory, presented by Roland Horde. This is a video presentation on wells, both before and after stimulation, using chloride or other ions to map fractures ...
Authors
Horne, R. and Schneider, M. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgestanford universitystanfordstimulationfracturesfracingsewer camflow magnitudeschloridechloride concentrationion concetrationfracture networkpresentationvideoegs

Utah FORGE 3-2417: DAS Microseismic Event Records From Circulation Test July 2023

Jul 09, 2025
17.07 GB
Publicly accessible
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (waveforms) recorded during the 16A-16B circulation tests conducted at the Utah FORGE site in July 2023 as part of the FOGMORE R&D project (Utah FORGE Project 3-2417). Data were acquired using Sil...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdasdistributed acoustic sensingmicroseismiccirculation testfiber optic monitoringsilixa carinasilixa idas v2nanostrain rateseismic dataseg-yjuly 2023raw datatriggeredchannel map

MT Data: Newberry 4D Monitoring EGS Project

Apr 12, 2016
Size unavailable
Publicly accessible
This submission contains a link to the EDX Collaborative Workspace where the MT data collected in support of the DOE GTO 4D EGS monitoring project is stored. Daily production reports- Oregon State University (OSU) had 6 stations running continuously. --Dynamic survey map, KML f...
Authors
Rose, K. National Energy Technology Laboratory
geothermalenhanced geothermal systemegsmtnewgennewberryoregonmagnetotelluricgeophyscisgeophysicsedxmonitoringstimulation

Utah FORGE: Well 16B(78)-32 Extended Dual Well Circulation Testing Fiber Optic Monitoring Report August 2024

Aug 30, 2024
10.95 MB
Publicly accessible
This report documents the post-hydraulic fracturing extended circulation test between Utah FORGE wells 16A and 16B conducted in August 2024. In well 16B, fiber optic measurements of Rayleigh frequency shift distributed strain sensing (RFS-DSS) and distributed temperature sensing ...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergycirculation testscross well circulationfiber opticsrfs dssdtsstrain changethermal sluggingthermal strainpltproduction logging toolutah forgeegsstimulaitonhydraulic fracturingdssdistributed temperature sensingdistributed strain sensingfiber optic monitoringprocessed datatechnical reportneubrexgeophysics16b78-32

Fault Information and Seismicity for the Portland Basin Deep Direct-Use Feasibility Study

Dec 04, 2018
62.49 MB
Publicly accessible
Included in this dataset is a spreadsheet with the primary fault information used in the basin model, a spreadsheet with earthquake magnitude estimates, and a figure showing location of faults and microseismicity in the Portland Basin
Authors
Streig, A. and Wells, R. Portland State University
geothermalenergyddudeep direct-usethermal energy storageddu-tesseismicityearthquakefaultstructural geologymagnitudeeventmicroseismicityportlandbasinoregonormodelfeasibilityoatfield faulteast bank faultgales creek faultmount angel faultnewberg faultfrontal faultbolton faultcanby-molalla faulthelvetia faultbeaverton faultsherwood faultdip directiondip anglefault length

Subsurface Characterization and Machine Learning Predictions at Brady Hot Springs Results

Oct 20, 2021
6.41 MB
Publicly accessible
Geothermal power plants typically show decreasing heat and power production rates over time. Mitigation strategies include optimizing the management of existing wells increasing or decreasing the fluid flow rates across the wells and drilling new wells at appropriate locations. Th...
Authors
Beckers, K. et al National Renewable Energy Laboratory
geothermalenergymachine learningmlsubsurfacecharacterizationbrady hot springsbhspredictionreservoir modelingtime seriespcaprincipal component analysisreservoir managementreservoirdual-porositystimulationinjection testpdetemperatureflowpressuresimulationsingle-fracturedoubletheat maptensorflowcnnlstmmlphydrothermalopen source reservoirosrnevada

Subsurface Characterization and Machine Learning Predictions at Brady Hot Springs

Feb 18, 2021
4.49 MB
Publicly accessible
Subsurface data analysis, reservoir modeling, and machine learning (ML) techniques have been applied to the Brady Hot Springs (BHS) geothermal field in Nevada, USA to further characterize the subsurface and assist with optimizing reservoir management. Hundreds of reservoir simulat...
Authors
Beckers, K. et al National Renewable Energy Laboratory
geothermalenergymachine learningsubsurfacecharacterizationbrady hot springspredictionreservoir modelingtime seriespcaprincipal component analysisreservoir managementbradys hot springsporotomoreservoirdual-porositystimulationinjection testmodeltemperatureflowpressuresimulationsingle-fracturedoubletheatmapheat maptensorflow

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

Final Report: Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Nov 18, 2015
31.13 MB
Publicly accessible
This is a final report summarizing a two-year (2014-16) DOE funded Geothermal Play Fairway Analysis of the Low-Temperature resources of the Appalachian Basin of New York, Pennsylvania and West Virginia. Collaborators included Cornell University, Southern Methodist University, and ...
Authors
E. Jordan, T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacitygpfa-abgeothermal play fairway analysisthermal analysisresource assessmentheat flowthermal conductivitygeothermsheat utilizationsurface leveled cost of heatlcohslcohdemandgeophirescombined risk segment mapsrisk analysisinduced seismicityfaultspotential fieldswaveletsbht correctionslow temperature

EGS Collab: Modeling and Simulation Working Group Teleconference Series (1-98)

Feb 04, 2020
11.93 GB
Publicly accessible
This submission contains the presentation slides and recordings from the first 98 EGS Collab Modeling and Simulation Working Group teleconferences. These teleconferences served three objectives for the project: 1) share simulation results, 2) communicate field activities and resul...
Authors
White, M. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsmodelingtemperatureheat flowdtstracerpressureinjection testflowc-dots
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service