OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 36.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"field measurements"×
Drilling and Completion×

Project Red: Well 34A-22 Casing Integrity, Trajectory, Cement Bond, and Mudlog Data 2022

Jul 30, 2025
11.23 MB
Awaiting release
This dataset contains borehole logging data acquired in March-July 2022 from Fervo Energy geothermal wells in the Blue Mountain Geothermal Field, Humboldt County, Nevada. The submission includes casing inspection and cement evaluation logs, directional and trajectory measurements,...
Authors
Dadi, S. et al Fervo Energy
geothermalenergygeothermal wellswell loggingborehole loggingblue mountain geothermal fieldhumboldt countynevadafervoschlumbergerhalliburtonhorizonbm 34a24-23-22bm 34a31-23-22blue mountain 34alascasing inspectioncement bondacoustic cement evaluationtrajectory logsdirectional logsmudloglogsraw dataprocessed data

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

Project Red: Monitoring Well 73-22 Geophysical and Mud Logging Data 2022

Jul 30, 2025
19.14 MB
Awaiting release
This dataset contains open-hole geophysical and mud logging measurements acquired in 2022 from Monitoring Well 73-22 in the Blue Mountain Geothermal Field, Humboldt County, Nevada. Data were collected by Baker Hughes, Baker Atlas, Horizon Well Logging, and other service providers ...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyblue mountainblue mountain geothermal fieldegsnevadahumboldt county73-22monitoring wellproject redgeothermal well logswell logsgeophysical loggingmud loggingacoustic slownesscompressional slownessshear slownessstoneley wavemonopole acousticdipole acousticazimuthal anistropygamma ray logresistivity logneutron porositydensity logcaliper logborehole conditionsbulk modulusshear modulusmechanical propertieslithologyalteration mineralsfracturesgas detectionlasraw dataprocessed datafervo

Practices Maintain Straight Hole in Crooked Hole Conditions, While Also Enabling Significant Gains in Drill Rate

Apr 30, 2014
Size unavailable
Publicly accessible
Bottom hole assembly (BHA) designs were assessed in field trials for their ability to achieve critical low inclination requirements, while simultaneously enabling high drill rates. Because angle has historically been controlled by reducing weight on bit (WOB), these are often com...
Authors
Knudsen, S. et al Sandia National Laboratories
geothermalbhadrillingpacked bhapendulum bhamsemcginness hills fieldwobbottom hole assemblyweight on bitmechanical specific energyspeinclinationanglemcginness hills

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Publicly accessible
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Cape EGS: Gold 6-IB: Mud Log, Mass Spectrometry, and Dipole Sonic-Derived Geomechanical Data

Apr 30, 2025
20.64 MB
Awaiting release
This dataset includes geological and geophysical well log data from the Gold 6-IB well at the Cape EGS site in Utah, collected between January and April 2025. The data span the full well depth from surface to total depth (15,054 feet) and encompass mud log information, mass spectr...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsgold 6-ibmud logmass spectrometrydipole sonicgeomechanicsutah forgeacoustic slownessporosityanisotropywell logsgas analysislaslithologyraw data

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

INGENIOUS Thermal Conductivity Measurement Source Categorization

Jun 01, 2021
907.64 kB
Publicly accessible
Thermal conductivity (TC) data taken for different wells at a specified drill depth. This is an abridged version of the complete SMU heat flow database, downloaded from the SMU node of the NGDS at the beginning of INGENIOUS (approximately April 2021), and filtered to the INGENIOUS...
Authors
Batir, J. and Gentry, E. University of Nevada, Reno
geothermalenergythermal conductivityingeniouswelldrillingthermalconductivitytestmeasurmentdataraw datasmunevadadatabasenotestcngdsheat flowheatporosity

Lost Circulation Materials in Geothermal Drilling: Thermal Degradation, Viscosity, Compression, and Flow Loop Tests

Feb 01, 2022
2.29 GB
Publicly accessible
This dataset provides a set of experimental data on the performance of lost circulation materials (LCMs) used in geothermal drilling operations. It includes results from four distinct tests: thermal degradation, viscosity measurements, compression tests, and high-temperature flow ...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergylost circulation materialslcmgeothermal drillingdrillingraw dataprocessed datamass loss measurementslost circulation managementdegradationthermal degradationdegradation patternrheologyfluiddrilliing fluidhigh temperatureflow testcompression testflow loop testsealingviscosity measurements

High-Temperature Self-Healing Geothermal Cement Composites

Mar 21, 2017
14.26 MB
Publicly accessible
A presentation with notes showing an overview of the last 6 months of the project on high-temperature self-healing inorganic cement composites. General approach, test methods and results for the self-healing cement composites are presented. Data include strength recoveries for 9 c...
Authors
Pyatina, T. and Sugama, T. Brookhaven National Laboratory
geothermalenergycement compositesself-healinghigh temperaturestrength recoverycrackfracturesealingbonding recoverycementtechnologyintegritywellboreinterface

Utah FORGE: Video of Utah FORGE Drilling Planning for Production Well 16B(78)-32

Mar 03, 2023
10.06 MB
Publicly accessible
This is a YouTube video containing the specifics of well planning for Utah FORGE 16B(78)-32. This well will be drilled as a doublet approximately 300 feet parallel to and above 16A(78)-32 and will be drilled between approximately April 15th and July 17th 2023.
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergywell planningutah forgewell 16b78-32well planning videoegsdrillingdoublet pairfiber opticstress measurementvibrationsinjection testingcirculation testingprocessed data

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data

Technology Development and Field Trials of EGS Drilling Systems at Chocolate Mountain

Jan 01, 2012
23.51 MB
Publicly accessible
Polycrystalline diamond compact (PDC) bits are routinely used in the oil and gas industry for drilling medium to hard rock but have not been adopted for geothermal drilling, largely due to past reliability issues and higher purchase costs. The Sandia Geothermal Research Departmen...
Authors
Knudsen, S. et al Sandia National Laboratories
geothermalchocolate mountainsdrillingpdc bitroller conegranitechocolate mountains drillingsynthetic diamondrate of penetrationegslateral vibration spectrumcaliforniacasouthern californiasocaldrilling recordsperformance datadrilling chartsbefore and afterpicturesvibration spectrum

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Western USA Assessment of High Value Materials in Geothermal Fluids and Produced Fluids Final Report

Mar 18, 2019
12.34 MB
Publicly accessible
This report documents the results of investigations dealing with the concentrations and availabilities of strategic, critical and valuable materials (SCVM) in produced waters from geothermal and hydrocarbon reservoirs (50-250 degrees C) in Idaho, Nevada, New Mexico, Oregon, and Ut...
Authors
Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergystrategic critical metalsproduced geothermal fluidsproduced hydrocarbon fluidswestern usanevadautahidahooregonnew mexicogeologyproduction fieldsfluidgeochemistrytrace elementsstable isotopeshelium isotopesrocksdrill cuttingscalcite scalesroosevelt hot springsdixie valleybeowawemineralogy-lithologymineralogylithologycritical elementsmineral depositsdrillingproducedwaterreservoirtrace elementmineraldepositgeologicalgeochemicalcoproducedscvmstrategiccritical and valuable materials

2011 Glass Buttes Exploration and Drilling

Jan 01, 2011
1.27 MB
Publicly accessible
2011 Geothermal Technologies Program Peer Review Presentation summarizing relevance, proposed approach, and logistics of the Glass Buttes Exploration and Drilling.
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermalalterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidarhyperspectralgravitymineral assemblages3d geologic modelfield workexplorationdrilling

Cape EGS: Gold 4-PB: Mudlog, Mass Spectrometry, Triple Combo, and Dipole Sonic-Derived Geomechanical data

Apr 30, 2025
30.1 MB
Awaiting release
This dataset includes geological and geophysical well logs from the Gold 4-PB well at the Cape EGS site near Utah FORGE, collected between December 2024 and January 2025. The dataset covers lithological, geochemical, and petrophysical data acquired during and after drilling. Data ...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsutah forgeegsgold-4-pbgoldmass spectrometrymud logtriple combodipole sonicgeomechanicspetrophysicsresistivityporositywell logsanisotropygas analysislasraw data

Cornell University Borehole Observatory Pason Drilling Parameters

Jun 24, 2026
137.28 MB
In progress
This data set included drill rig drilling parameters from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 an...
Authors
Fulton, P. et al Cornell University
geothermalenergyegsdirect useappalachian basindrilling datacornell universitycubodeep direct useddudistrict heatingdeep welldrillingesh-1api 31109300030000

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Exploration Best Practices on OpenEI

Sep 20, 2013
63.84 kB
Publicly accessible
This is an electronic database detailing different types of, various phases of, best practices for, and cost and time associated with geothermal exploration techniques. The groups of exploration techniques included in the database are Data and Modeling Techniques, Downhole Techniq...
Authors
Young, K. National Renewable Energy Laboratory
geothermalexplorationgeophysicsopeneiremote sensingconceptual modelsexploration costsbest practicesloggingdrillinggeochemistryresistivity surveymt surveyelectromagnetic surveygravityseismicisotopelidarhyperspectralmultispectralswirflirinsarsarreflectionrefractonmagneticsdc resistivity2-m probewell loggingdatabase link

Sedimentary Geothermal Feasibility in Nevada, Western Utah, Colorado, and the Gulf Coast Region of Texas Final Report

Jul 01, 2020
Size unavailable
Publicly accessible
The objectives of this project were to (1) perform a literature review of sedimentary geothermal resources, (2) identify data sources and develop data-collection methodologies that characterize selected resources, (3) screen sedimentary basins and formations for sedimentary geothe...
Authors
Johnston, H. et al National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitysedimentary basinelko basinrailroad valleysteptoe valleypavant buttedenver basinpiceance basinraton basingulf coast regionnevadautahtexasgbcaasgreat basin carbonate and alluvial aquifer systemcarbonateagsadvanced geothermal systembottom-hole temperaturewell datalcoeeconomicsupperlowercarbonate aquifer unitegsenhanced geothermal systemplay fairway analysiscoloradotemperaturebottom-holemarys river basindrillingpermeabilityreservoirmodelingcarbonate geothermal systemcgstechno-economicanalysisdownselectsubsurfacedata mininggeologygradientheatflowgeophysicsseismicclosed-loophydrogeologycoststructuralbedrockmapaquifersedgeo
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service