OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 296.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"pressure gradient"×

West Flank Coso FORGE: Well 74-2TCH Temperature, Pressure, Well History, Well Bore Schematic

May 13, 2016
58.79 MB
Publicly accessible
Temperature logs, pressure logs, directional survey, well history, well bore schematic, and other reports for well 74-2TCH at West Flank FORGE
Authors
Blankenship, D. Sandia National Laboratories
geothermalwelltemperature logforgeegsmud logdaily reportsdrill rigstatic surveywell completionsurvey plotssundry noticetemperature gradientpressure gradientthin sectionswell historywellbore schematicwell schematichistoryschematictemperaturepressure74-2tchlogcoso

West Flank Coso FORGE: Well 48-11TCH Temperature, Pressure, Directional, Well History, Wellbore Schematic

May 13, 2016
41.29 MB
Publicly accessible
Temperature logs, pressure logs, directional survey, well history, well bore schematic, and other reports for well 48-11TCH at West Flank FORGE
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgewell datatemperature logsmud logswest flankdaily drilling reportswell loghydrothermal veinshydrothermal clay abundanceresistivitylithologybreccia zonesdirectional surveystatic surveywell historywellbore schematicwell schematicbottomholegeothermal exploration permitsundry noticegradientservice reportloggingwell completionwellborecosotemperaturepressuredirectionalwellhistoryschematic48-11tchdata

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Fracture Sustainability Pressure, Temperature, Differential Pressure, and Aperture Closure Data

Sep 30, 2016
8.04 MB
Publicly accessible
In these data sets, the experiment time, actual date and time, room temperature, sample temperature, upstream and downstream pressures (measured independently), corrected differential pressure (measured independently and corrected for offset and room temperature) indication of ape...
Authors
Kneafsey, T. Lawrence Berkeley National Laboratory
geothermalexperimentalfracturemechanicsgeochemistrypressuretemperaturedifferential pressureaperturedesert peaktitaniumgranitepressure gradientfracture investigation

Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
97.37 MB
Publicly accessible
This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egsroosevelt hot springutah geothermal wellswell logsutah well logsutah geothermalgeothermal well logsroosevelt hot springswater analysiswater qualitygeochemistryflow samplewireline samplepressure surveytemperature surveysubsurfacehistorywell schematicsite mapwell locationscasing schematicwell completionbhtgradienthydrothermal alterationcompensated soniccompensated neutronformation densityporositylaterlogdual inductionelectromagneticelectro-magneticthickness toolfracture identificationmud logcaliperboreholedownholegeophysicssurveygeophysicalgeochemicalwell datautah52-21well logresourcecharacterizationmilford

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Utah FORGE: Well 58-32 Stimulation Conference Paper and Data

Apr 24, 2019
1.8 MB
Publicly accessible
The U.S. Department of Energy's (U.S. DOE) Frontier Observatory for Research in Geothermal Energy (FORGE) is a field laboratory that provides a unique opportunity to develop and test new technologies for characterizing, creating and sustaining Enhanced Geothermal Systems (EGS) in ...
Authors
Best, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeopen hole stimulationwell 58-32 stimulationwell 58-32utah geothermalgrgegsdisccrete fracture flowreservoir stimulationstimulationhydraulic fracturingphase 2cforgepressureflowbackratetemperaturehydraulicflowutahopen-holemilfordroosevelt hot springspre-processedupper perforationlower perforationmicroseismicitydasdistributed acoustic sensinggeophysics

Hot Pot: Contoured Temperature Gradient Map

Jun 28, 2013
90.5 kB
Publicly accessible
Temperature gradient contours derived from Oski temperature gradient hole program and from earlier published information.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot pottemperature gradientmap packagemetadatagisgeospatial data

Utah FORGE: Temperature Gradient Database

Feb 01, 2004
Size unavailable
Publicly accessible
This is a temperature gradient database for Utah, USA. It is located at the Utah Geological Survey. This contains data relevant to the Utah FORGE project.
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermaltemperature gradientsutah temperature gradientsforgeutah forgeegsutah geothermalutahtemperaturegradienttemperature gradientresourcecharacterizationmilfordroosevelt hot springs

Maui Aeromagnetic Survey

Apr 17, 2010
90.3 MB
Publicly accessible
Map, image, and data files, and a summary report of a high-resolution aeromagnetic survey of southern Maui, Hawai'i completed by EDCON-PRJ, Inc. for Ormat Nevada Inc using an helicopter and a towed sensor array.
Authors
Akerley, J. Ormat Nevada Inc
geothermalhawaiimauiaeromagaeromagneticssurveymagnetometergeometricshaleakalavolcanototal magnetic intensityreduced to polehorizontal gradienttiltderivative

SW New Mexico Play Fairway Analysis: BHT Geothermal Gradient Calculations

Jul 24, 2015
133 kB
Publicly accessible
This file contains a compilation of BHT data from oil wells in southwestern New Mexico. Surface temperature is calculated using the collar elevation. An estimate of geothermal gradient is calculated using the estimated surface temperature and the uncorrected BHT data.
Authors
Kelley, S. New Mexico Bureau of Geology and Mineral Resources
geothermalgeothermal gradientsouthwestern new mexicobhtsw new mexicotemperaturegradientsurfacenew mexiconmsouthwestdepthresourceexplorationpfaplay fairway analysischaracterizationwell data

Validation of Innovative Exploration Technologies for Newberry Volcano: Lithology Reports of TGWs

Jan 01, 2012
Size unavailable
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Lithology Reports of Temperature Gradient Wells
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
newberryvolcanocalderainnovative exploration technologieslithologytemperature gradient welltgwiettgtemperature gradientwellreportsexplorationhydrothermalegs

Deep Direct-Use Feasibility Study Numerical Modeling and Uncertainty Analysis using iTOUGH2 for West Virginia University

Dec 20, 2019
384.67 MB
Publicly accessible
To reduce the geothermal exploration risk, a feasibility study is performed for a deep direct-use system proposed at the West Virginia University (WVU) Morgantown campus. This study applies numerical simulations to investigate reservoir impedance and thermal production. Because of...
Authors
Garapati, N. et al West Virginia University
geothermalwvutuscaroraitough2lbnlreservoir flow modelpermeabilityfracturematrixuncertainty analysisnumerical modelingmonte carlofirst-order-second-moment uncertainty propagation analysisfeasibilityddudeep direct-usemorgantownreservoir impedancethermal productionresource potentialthermal breakthroughpermeability modelseconomic analysispapergeothermicsgeothermal exploration riskexploration riskmodelingeconomicdirect usewest virginia universitytuscarora sandstoneflow modeluncertaintyanalysissimulationflow

Acquisition and Processing of a Detailed Aeromagnetic Survey Glass Buttes, Oregon

May 27, 2010
11.33 MB
Publicly accessible
Using an ultra-light aircraft, a high-resolution aeromagnetic survey was carried out over Ormat Nevada's Glass Buttes project area in Oregon. Survey operations were completed on May 25, 2010. Average terrain clearance was 223 meters from the sensor. A total of 1,352 line-miles o...
Authors
Akerley, J. Ormat Nevada Inc
geothermaloregonaeromagneticmagnetic surveyaeromagneticsgeophysicshorizontal gradientrtptilt derivativemagnetic anomalytmiorsurvey maplocation mapsurvey linesmagnetic anomaly maptotal magnetic intensityreduction to polemagneticsglass buttesreduced to polereportmap

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Proposed Drill Sites

Jun 28, 2013
122.43 kB
Publicly accessible
Proposed drill sites for intermediate depth temperature gradient holes and/or deep resource confirmation wells. Temperature gradient contours based on shallow TG program and faults interpreted from seismic reflection survey are shown, as are two faults interpreted by seismic contr...
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potdrill sitestemperature gradientfaultsseismic reflection surveytemperature gradientmap packagegisgeospatial data

Analyzed DTS Data, Guelph, ON Canada

Jul 01, 2015
4.73 MB
Publicly accessible
Analyzed DTS datasets from active heat injection experiments in Guelph, ON Canada is included. A .pdf file of images including borehole temperature distributions, temperature difference distributions, temperature profiles, and flow interpretations is included as the primary analyz...
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperatureguelphimagespressuregradientwelldrill-holecodeontariocamatlab

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Penrose Well Temperatures

Mar 15, 2013
6.69 kB
Publicly accessible
Penrose Well Temperatures Geothermal waters have been encountered in several wells near Penrose in Fremont County, Colorado. Most of the wells were drilled for oil and gas exploration and, in a few cases, production. This ESRI point shapefile utilizes data from 95 wells in and a...
Authors
Christopherson, K. Flint Geothermal, LLC
geothermalcoloradofremont countytemperature gradientsoil and gas wellstemperature gradientpoint shapefileshapefileshape filewell datatemperaturepenrose welldatageospatial data

Validation of Innovative Exploration Technologies for Newberry Volcano: Drilling Summary

Jan 01, 2012
84.24 kB
Publicly accessible
Drilling summary from validation of innovative exploration technologies for Newberry Volcano, including depths, dates, and drilling statistics from 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermaldrilling datanewberryoregonvolcanocalderaexplorationinnovative exploration technologiesdrillingietsummarystatisticswelldatawell datatgwtgtemperature gradienthydrothermalegs

Preliminary Drill Sites

Jun 28, 2013
158.67 kB
Publicly accessible
Preliminary locations for intermediate depth temperature gradient holes and/or resource confirmation wells based on compilation of geological, geophysical and geochemical data prior to carrying out the DOE-funded reflection seismic survey.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potdrill sitestemperature gradientmap packagegisgeospatial data

Tularosa Basin Play Fairway Analysis: Partial Basin and Range Heat and Zones of Critical Stress Maps

Nov 15, 2015
3.06 MB
Publicly accessible
Interpolated maps of heat flow, temperature gradient, and quartz geothermometers are included as TIF files. Zones of critical stress map is also included as a TIF file. The zones are given a 5km diameter buffer. The study area is only a part of the Basin and Range, but it does inc...
Authors
Brandt, A. University of Utah
geothermalfort blisstularosa basintularosanew mexicocritical stressquartz geothermometerheat flowheatflowtemperature gradientmapsmapbasin and rangegreat basinutahnevadainterpolationextrapolationquartzgeothermometertemperaturegradientzonesfaultpermeabilitypfaplay fairway analysisgeothermometrygeospatial data

Play Fairway Analysis CA-NV-OR: San Emidio Geophysical Data

Aug 05, 2015
12.56 MB
Publicly accessible
Various geophysical exploration data for San Emidio KGRA
Authors
M, C. University of California
geothermalgeophysicssan emidiogravityself potential resistivitygradiometrymagneticpsinsargeophysical surveyinvestigationassessmentsurveysiteresourcespinterferometrygradientremote sensingmagneticsinsarca-nv-orpfaplay fairway analysis

Snake River (Idaho) Geothermal Drilling Project: Innovative Approaches to Geothermal Exploration

Feb 21, 2014
105.74 MB
Publicly accessible
The goal of our project was to test innovative exploration technologies using existing and new data, and to ground-truth these technologies using slim-hole core technology. The slim-hole core allowed us to understand subsurface stratigraphy and alteration in detail, and to correla...
Authors
Shervais, J. et al Utah State University
geothermalenergyslimhole drillingsnake river plaininnovative explorationkimamakimberlymountain homebasaltrhyolitegeophysicsgeochemistrytechnicalassessmentprocessed dataidahoconceptual model

Washington Play Fairway Analysis Geothermal Heat and Permeability Potential Geodatabases

Dec 15, 2015
309.26 MB
Publicly accessible
This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeli...
Authors
Norman, D. et al Washington Division of Geology and Earth Resources
geothermalmount st. helens seismic zonewind river valleymount bakerpermeabilityheatfavorabilityuncertaintyrisksensitivityplay-fairwaywashingtoncascade rangeslip tendencydilation tendencysigma 3maximum coulomb shear stressdisplacementdisplacement gradientmaximum shear strain ratedilational strain ratefaultvolcanic ventintrusive rocktemeprature gradientgeothermometryhot springfumarolegeothermal favorabilitystrain rategisarcgisgeospatial datageodatabasegdbwashington statepfa
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service