OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 15 of 15.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"sedimentary aquifers"×
EGS×

Sedimentary Geothermal Feasibility in Nevada, Western Utah, Colorado, and the Gulf Coast Region of Texas Final Report

Jul 01, 2020
Size unavailable
Publicly accessible
The objectives of this project were to (1) perform a literature review of sedimentary geothermal resources, (2) identify data sources and develop data-collection methodologies that characterize selected resources, (3) screen sedimentary basins and formations for sedimentary geothe...
Authors
Johnston, H. et al National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitysedimentary basinelko basinrailroad valleysteptoe valleypavant buttedenver basinpiceance basinraton basingulf coast regionnevadautahtexasgbcaasgreat basin carbonate and alluvial aquifer systemcarbonateagsadvanced geothermal systembottom-hole temperaturewell datalcoeeconomicsupperlowercarbonate aquifer unitegsenhanced geothermal systemplay fairway analysiscoloradotemperaturebottom-holemarys river basindrillingpermeabilityreservoirmodelingcarbonate geothermal systemcgstechno-economicanalysisdownselectsubsurfacedata mininggeologygradientheatflowgeophysicsseismicclosed-loophydrogeologycoststructuralbedrockmapaquifersedgeo

Utah FORGE: AGRC GIS Database for the State of Utah

Mar 02, 2016
Size unavailable
Publicly accessible
This is a link to the Automated Geographic Reference Center (AGRC) that houses GIS data for the state of Utah. This includes geoscience, cadastre, elevation and terrain, digital aerial photography, roads, aquifer data, etc. Several GIS datasets used in the Utah FORGE project origi...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgegis datautah shapefilesutah roadsutah cadastreutah elevation datautah terrain datautah aquifersutah geoscience datautah cadastre datautah aquifer dataagrcutahgeospatial datageosciencecadastreelevationterrainaerial photographydigitalroadsaquifertopographybase mapimageryparcelsland ownershipgeologyearthquakeswaterremote sensing

Low-Temperature Hydrothermal Resource Potential Estimate

Jun 30, 2016
2.79 MB
Publicly accessible
Compilation of data (spreadsheet and shapefiles) for several low-temperature resource types, including isolated springs and wells, delineated area convection systems, sedimentary basins and coastal plains sedimentary systems. For each system, we include estimates of the accessible...
Authors
Mullane, M. et al National Renewable Energy Laboratory
geothermalhydrothermallow-temperaturedirect usespringswellsdelineated areasedimentary basinaccessible resource basemean extractable resourcebeneficial heatusgsresource potentialcoastal plainslow temperatureegsdepthshallow temperauteconvectionconductioncoastal plainisolatednrelsmubottom-hole-temperaturetemperature datadepth dataisolated systemshapefilegis data

Utah FORGE: Data for 3-D Model Development Lithology, Temperature, Pressure, and Stress

Mar 17, 2020
25.73 MB
Publicly accessible
This submission comprises two downloadable .zip archives. Each archive contains spreadsheets with 3-D data and a .txt document describing the data. The Mesh Files .zip download contains data regarding the lithologic contacts of the granitoid and overlying sedimentary basin fill. T...
Authors
Podgorney, R. Idaho National Laboratory
geothermalenergyutah forgeforge3-d modellingearth modellithologic contactspressurestresslithologyutahtemperature datamodelingraw datapreprocessedegstemperature3dmilfordmesh filegranitoidbasin fillinitial conditionsnumericalmodelreservoirresourcecharacterizationroosevelt hot springs

Fallon FORGE: 3D Geologic Model

Mar 01, 2018
949.28 kB
Publicly accessible
The 3D geologic model for the Fallon for site was constructed in EarthVision software using methods similar to (Moeck et al., 2009, 2010; Faulds et al., 2010b; Jolie et al., 2012, 2015; Hinz et al., 2013a; Siler and Faulds, 2013; Siler et al., 2016a, b) References are included in ...
Authors
Blankenship, D. and Siler, D. Sandia National Laboratories
geothermalenergyforgeegsgeologymodelearthvisionfaultsstratigraphyvetted-no3dfallonnv3d modelingfaultingstructurenevadamodellinggeologic

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Utah FORGE 3-2535: Preliminary Report on Development of a Reservoir Seismic Velocity Model

Jan 30, 2023
5.8 MB
Publicly accessible
This report describes the development of a preliminary 3D seismic velocity model at the Utah FORGE site and first results from estimating seismic resolution in the generated fracture volume during Stage 3 of the April 2022 stimulation. A preliminary 3D velocity model for the larg...
Authors
Gritto, R. Array Information Technology
geothermalenergy3d seismic velocity modelseismic resolutionseismicgeophysicsreservoirmodelvelocityforgeutah forgeegscharacterizationreportpreliminarymilfordphasenetneural networkingmachine learningdeep learning

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

GLADE Project: Lessons Learned Document

Aug 28, 2026
16.29 MB
In curation
Lessons Learned document for the GLADE Geothermal Drilling project in the DJ Basin, Colorado. The Geothermal Limitless Approach to Drilling Efficiencies (GLADE) project was undertaken to evaluate whether advanced oil and gas drilling practices could be adapted to improve geotherm...
Authors
Rhodes, R. OXY USA Inc.
geothermalenergylessons learneddj basincoloradogladedrillingegs

Fallon FORGE: Seismic Reflection Profiles

Feb 01, 2018
33.35 MB
Publicly accessible
Newly reprocessed Naval Air Station Fallon (1994) seismic lines: pre-stack depth migrations, with interpretations to support the Fallon FORGE (Phase 2B) 3D Geologic model. Data along seven profiles (>100 km of total profile length) through and adjacent to the Fallon site were re-...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallonnevadaseismicreflectionvetted-nodepth migrationgeophysicsprocessed dataprestackinterpretedsite mapsurvey mapreprocessed datareprocesseddata

GLADE Project: Pre-Feasibility Economic Evaluation by National Lab of the Rockies

Aug 28, 2026
1.96 MB
Publicly accessible
The Geothermal Limitless Approach to Drilling Efficiencies (GLADE) project was undertaken in Denver-Julesburg (DJ) Basin Colorado to evaluate whether advanced oil and gas drilling practices could be adapted to improve geothermal well construction in deep, hot, hard-rock environmen...
Authors
Mibei, G. et al OXY USA Inc.
geothermalenergyeconomic evaluationdj basincoloradogladetechno-economicclosed-loopegsfeasibilitythermophysicaldrilling costlcoe sensitivity

Cornell University Borehole Observatory Pason Drilling Parameters

Jun 24, 2026
137.28 MB
In progress
This data set included drill rig drilling parameters from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 an...
Authors
Fulton, P. et al Cornell University
geothermalenergyegsdirect useappalachian basindrilling datacornell universitycubodeep direct useddudistrict heatingdeep welldrillingesh-1api 31109300030000

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service