OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 79.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"text file"×
Gravity×

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Utah FORGE: Composite Raw Gravity Data 2021

Jun 04, 2021
7.3 kB
Publicly accessible
This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in me...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeutah forge gravity 2021forge gravity 2021gravity dataraw gravity dataraw datadatautahforgegravitygeophysicsgeophysicalgravimeter

Utah FORGE: Raw Microgravity Composite Data Updated 10/2021

Oct 01, 2021
7.98 kB
Publicly accessible
This is a microgravity dataset from the Utah FORGE site near Milford, Utah. This composite dataset was updated in October, 2021 and contains data from December 17th, 2018 through September 24th, 2021. The data includes the GPS location of the measurement, date of the measurement, ...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergygravity datamicrogravity datautah forgeutah forge microgravityutah forge gravityutah geothermalmigrogravitygravitydatageophysicsutahraw datagpsgravity station

Gravity Data for West-Central Colorado

Apr 06, 2012
164.99 MB
Publicly accessible
Modeled Bouger-Corrected Gravity data was extracted from the Pan American Center for Earth and Environmental Studies Gravity Database of the U.S. at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was open...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalgravitybougercoloradoshapefilepoint shapefileline shapefileshape filegisarcgisgeospatialcontourwestcentralwest-centraldatageospatial data

Utah FORGE: Phase 3 Magnetotelluric (MT) Data

Oct 01, 2020
91.86 MB
Publicly accessible
New high-quality tensor MT data at 122 sites, including the vertical magnetic field and utilizing ultra-remote referencing, have been acquired over the Utah FORGE project area. The results will be used to delineate the densities of faults and fractures in crystalline basement rock...
Authors
Wannamaker, P. and Maris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge mtmt datamagnetotelluric datautah forgeforgeutah geothermalgeophysical datafinite elementfeafemgeophysicsgravitymagneticsmagnetotelluricsseismicgeodesyegsroosevelt hot springsmilfordsite characterization

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Publicly accessible
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Spatially Referenced Geodatabase for Coso Geothermal Area

Dec 01, 2022
110.41 MB
Publicly accessible
Mineral, Temperature, Gravity, and Fault Density maps in the Coso Geothermal Field in California.
Authors
Demir, E. et al Colorado School of Mines
geothermalenergygeologygeophysicsgravitytemperaturemineralgeospatialrastercosocalifornia

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Geothermal Exploration Raster Files for Utah Play Fairway Analysis

Jun 16, 2017
1.19 MB
Publicly accessible
This submission contains raster files associated with several datasets that include earthquake density, Na/K geothermometers, fault density, heat flow, and gravity. Integrated together using spatial modeler tools in ArcGIS, these files can be used for play fairway analysis in rega...
Authors
Wannamaker, P. Energy and Geoscience Institute at the University of Utah
geothermalenergyexplorationplay fairway analysisgravityheatearthquakefaultgeothermometerutahsevierpfawesternrasterheat flowfault systemsspatialgeospatialeasterngreat basineastern great basingeospatial datageophysicscharacterization

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

Play Fairway Analysis CA-NV-OR: San Emidio Geophysical Data

Aug 05, 2015
12.56 MB
Publicly accessible
Various geophysical exploration data for San Emidio KGRA
Authors
M, C. University of California
geothermalgeophysicssan emidiogravityself potential resistivitygradiometrymagneticpsinsargeophysical surveyinvestigationassessmentsurveysiteresourcespinterferometrygradientremote sensingmagneticsinsarca-nv-orpfaplay fairway analysis

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Publicly accessible
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

Alum Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
252.81 MB
Publicly accessible
Data generated from the Alum Innovative Exploration Project, one of several promising geothermal properties located in the middle to upper Miocene (~11-5 Ma, or million years BP) Silver Peak-Lone Mountain metamorphic core complex (SPCC) of the Walker Lane structural belt in Esmera...
Authors
Miller, C. Ram Power, Inc.
geothermalgravitymagneticsmtgeochemistryregional temperatureresource modelwell datageologyupper miocenesilver peaklone mountainwalker lanealumesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countygrav-magmagnetic3dprofileprofilesround 12009round 22010magnetotelluricsinversion30 ohm100 ohm300 ohmztemchemistrygeothermometrytemperaturehole 56-29historicshallowwell logsmoderngeologicgeomechanicsgeophysical25-2926-19geologyreportexecutive summarymapssectionsphotosphotographspicturesgeospatial data

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data
1234Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service