Search GDR Data

Showing results 26 - 50 of 71.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Southwest New Mexico"×
Archive×

Utah FORGE: 2024 Discrete Fracture Network Model Data

Sep 08, 2024
1.4 GB
Publicly accessible
The Utah FORGE 2024 Discrete Fracture Network (DFN) Model dataset provides a set of files representing discrete fracture network modeling for the FORGE site near Milford, Utah. The dataset includes four distinct DFN model file sets, each corresponding to different time frames and ...
Authors
Finnila, A. and Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedfndiscrete fracture modellingfracturesstochastic fracturestensile fracturesdiscrete fracture network modelegsplanar fracturespermeabilityporositycompressibilitystoragemeqhydraulic stimulationmodelmodelingprocessed data

University of Illinois Campus Deep Direct-Use Feasibility Study Bedrock Geology ArcGIS Layers

Mar 20, 2018
3.31 MB
Publicly accessible
Bedrock Geology of Champaign County, Illinois, map layers (shapefiles). Layers included: 1) Champaign County bedrock units. 2) Champaign County bedrock surface contours. Contour interval of 25 feet. 3) Colchester coal surface contours. Contour interval of 50 feet. 4) Kimmswick...
Authors
Nelson, W. University of Illinois
geothermalenergychampaign countymahomet domebedrockcolchester coalkimmswick limestonenew albany shaleddudeep direct-usearcgisgeospatial datashapefileshape filegeologyil

Utah FORGE: Groundwater Data

Jul 20, 2016
621.85 kB
Publicly accessible
This submission includes two modeled drawdown scenarios with new supply well locations, a total dissolved solids (TDS) concentration grid (raster dataset representing the spatial distribution of TDS), and an excel spreadsheet containing well data.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmilfordutahegsforgegroundwaterdrawdownwellsupplytdsconcentrationgeochemistrywellsconcentrationsmodelaquifertesttransducerdataflow ratescenariowater tablemodelledpredictedpotentialgeospatial dataarcgisgisshapefileshape fileutah forgelocationwell locationreservoirsupply wellroosevelt hot springsresourcecharacterizationwell data

Slip and Dilation Tendency Analysis of the Patua Geothermal Area

Dec 31, 2013
15.36 MB
Publicly accessible
Critically stressed fault segments have a relatively high likelihood of acting as fluid flow conduits (Sibson, 1994). As such, the tendency of a fault segment to slip or to dilate provides an indication of which faults or fault segments within a geothermal system are critically st...
Authors
E., J. University of Nevada
geothermalpatua geothermal areaslip tendency analysisdilation tendency analysispatuafaultingfaultsstressfluid dlow conduitsambient stressshapefileshape filegisarcgisgeospatial datadata

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Appalachian Basin Play Fairway Analysis: Thermal Quality Analysis in Low-Temperature Geothermal Play Fairway Analysis (GPFA-AB)

Nov 15, 2015
2.04 GB
Publicly accessible
This collection of files are part of a larger dataset uploaded in support of Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB). Phase 1 of the GPFA-AB project identified potential Geothermal Play Fairways within the Appalachian basin of Pennsylva...
Authors
E., T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginialow-temperaturegeothermal play fairway analysisgpfa-abdeep direct usedistrict heatingthermal analysisresource assessmentheat flowthermal conductivitygeothermsshapefileregional gridrasterr scriptbasementtrenton black river projectsediment thicknessbht correctionrome troughgravitymagneticsworm based interpolation boundarieswormsrisk of seismicityoutlierthermal modelthermal fielddepth-to-temperaturetemperature-at-depthcross validationkrigingfavorable countiesarcgiscosunacorrelation of stratigraphic units of north americademdigital elevation modellow temperaturegeospatial datapfaplay fairway analysisthermal qualitycross-section

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

Gravity, Granite Springs Valley, Nevada Play Fairway Analysis

Sep 14, 2017
979.85 kB
Publicly accessible
All raw data for new data acquired, key grids such as CBA and horizontal derivative, acquisition report, and depth models. This gravity data is associated with the Nevada Play Fairway project.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
gravitygranite springs valleygeophysicspfanevadanvmodelingacquisitiongridscbahorizontal derivativedepthmodelrawdatainvertedprofilesectioncorrectedfree airtidetidalreportdensity contrastgsvnv great basin

Slip and Dilation Tendency Analysis of the Salt Wells Geothermal Area

Dec 31, 2013
6.75 MB
Publicly accessible
Critically stressed fault segments have a relatively high likelihood of acting as fluid flow conduits (Sibson, 1994). As such, the tendency of a fault segment to slip (slip tendency; Ts; Morris et al., 1996) or to dilate (dilation tendency; Td; Ferrill et al., 1999) provides an in...
Authors
E., J. University of Nevada
geothermalsalt wells geothermal areaslip tendency analysisdilation tendency analysisslip tendencydilation tendencysalt wellsfaultingfaultsstressfluid flow conduitsambient stressshapefileshape filegisarcgisdatageospatial data

Slip and Dilation Tendency Analysis of the San Emidio Geothermal Area

Dec 31, 2013
19.7 MB
Publicly accessible
Critically stressed fault segments have a relatively high likelihood of acting as fluid flow conduits (Sibson, 1994). As such, the tendency of a fault segment to slip (slip tendency; Ts; Morris et al., 1996) or to dilate (dilation tendency; Td; Ferrill et al., 1999) provides an in...
Authors
E., J. University of Nevada
geothermalsan emidio geothermal areaslip tendency analysisdilation tendency analysissan emidiofaultingfaultsstressfluid flow conduitsambient stressshapefileshape filegisarcgisslip tendencydilation tendencydatageospatial data

Slip and Dilation Tendency Analysis of McGinness Hills Geothermal Area

Dec 31, 2013
6.26 MB
Publicly accessible
Slip and Dilation Tendency in focus areas Critically stressed fault segments have a relatively high likelihood of acting as fluid flow conduits (Sibson, 1994). As such, the tendency of a fault segment to slip (slip tendency; Ts; Morris et al., 1996) or to dilate (dilation tendency...
Authors
E., J. University of Nevada
geothermalmcginness hills geothermal areaslip tendencydilation tendencyfaultingfaultsstressfluid flow conduitsambient stressshapefileshape filegisarcgisdatageospatial data

Slip and Dilation Tendency Analysis of the Tuscarora Geothermal Area

Dec 31, 2013
25.18 MB
Publicly accessible
Critically stressed fault segments have a relatively high likelihood of acting as fluid flow conduits (Sibson, 1994). As such, the tendency of a fault segment to slip (slip tendency; Ts; Morris et al., 1996) or to dilate (dilation tendency; Td; Ferrill et al., 1999) provides an in...
Authors
E., J. University of Nevada
geothermaltuscarora geothermal areaslip tendency analysisdilation tendency analysisslip tendencydilation tendencytuscarorafaultingfaultsfluid flow conduitsstressambient stressshapefileshape filegisarcgisdatageospatial data

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature

Appalachian Basin Play Fairway Analysis Thermal Risk Factor and Quality Analyses

Aug 02, 2016
197.39 MB
Publicly accessible
*This submission revises the analysis and products for Thermal Quality Analysis for the northern half of the Appalachian Basin (https://gdr.openei.org/submissions/638)* This submission is one of five major parts of a Low Temperature Geothermal Play Fairway Analysis. Phase 1 of the...
Authors
Jordan, T. Cornell University
geothermalappalachian basinwest virginiapennsylvanianew yorkdeep direct uselow temperaturedistrict heatingthermal analysisresource assessmentheat flowthermal conductivitygeothermsgeothermal play fairway analysisgpfa-abarcgispfatemperatureanalysisthermalrisk factorgeospatial data

West Flank Coso FORGE: Magnetotelluric Inversion

May 16, 2016
448.1 kB
Publicly accessible
The Coso Magnetotelluric (MT) dataset of which the West Flank FORGE MT data is a subset, was collected by Schlumberger / WesternGeco and initially processed by the WesternGeco GeoSolutions Integrated EM Center of Excellence in Milan, Italy. The 2011 data was based on 99 soundings ...
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegsmtwest flankinversion3dsurvey mapmagnetotelluriccosogeophysicsinversemodelreport

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. In this submission shp and tif files are zipped with al...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Laboratory Drilling Test Data of PDC bits with Sierra White Granite Rock

Oct 14, 2020
1.47 GB
Publicly accessible
This file contains unprocessed drilling data tests on Sierra White Granite (SWG) using two new PDC bits. The tests were conducted at Sandia National Laboratories (SNL) in the Hard Rock Drilling Facility (HRDF). The collected data includes ROP data at rotational speeds of 80, 120, ...
Authors
Al Dushaishi, M. and Hareland, G. Oklahoma State University
geothermalenergypdc bitsdrilling vibrationsdrilling testingsierra white graniteswgraw datahard rock drilling facilityhrdfdrill bitsdrill bit testingperformance testdrill bit testtorsional complianceaxial compliancecombined axial and torsional compliance

Fallon FORGE: Lithology Logs and Well 21-31 Drilling Data

Mar 11, 2018
128.85 MB
Publicly accessible
This submission includes lithology logs for all Fallon FORGE area wells; determined from core, cuttings, and thin section. Wells included are 84-31, 21-31, 82-36, FOH-3D, 62-36, 18-5, 88-24, 86-25, FOH-2, 14-36, 17-16, 34-33, 35A-11, 51A-20, 62-15, 72-7, 86-15, Carson_Strat_1_36-3...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyfallonforgeegsnevadalithologywellscorecuttingsdepth intervalsgeologyvetted-nodrill logwell loggeologic unitextentnvdrillingloggingmud reportdrilling parametersmud lossesdirectional drillingwireline logsfracturesmineralsmineralogytemperaturegasesgamma raygamma radiationself potentialspontaneous potentialresistivitynphole diametersphi21-31datawelllog

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Utilization Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
9.8 MB
Publicly accessible
This submission of Utilization Analysis data to the Geothermal Data Repository (GDR) node of the National Geothermal Data System (NGDS) is in support of Phase 1 Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin. The submission includes data pertinent to th...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadeep direct usedistrict heatingheat utilizationsurface levelized cost of heatslcohlcohgeothermal play fairway analysisgpfa-abdemandgeophirespfanortheasteastlow temperatureeconomicsrisk factorsplay fairway analysisgeospatial data

Hawthorne Nevada Deep Direct-Use Feasibility Study 3D Seismic

Mar 29, 2018
467.07 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. et al Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduopendtectpstmprestack time migrationfault interpretationhawthornegeospatial data

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw
<< Previous123Next >>