OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 36.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"county boundaries"×
Data×

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Analysis of Geothermal Resources in Three Texas Counties

Oct 30, 2020
37.52 MB
Publicly accessible
This project updates the geothermal resources beneath our oil and gas fields, as part of the research for the Texas GEO project. This report "Analysis of Geothermal Resources in Three Texas Counties" (October 2020) improves on previous mapping of the Texas resources for the counti...
Authors
Richards, M. and Batir, J. Southern Methodist University Huffington Department of Earth Sciences
geothermalenergytexas geobottom hole temperatureradiogenic heat productionthermal conductivity10 kmjackson county txcrockett county txwebb county txoil and gas wellstexasjackson countycrockett countywebb countyoil and gaswell dataformation temperaturetemperaturestratigraphyformationlithologytemperature gradientheat flowradiogenicmapborehole

U.S. Heat Demand by Sector for Potential Application of Direct Use Geothermal

Jun 23, 2016
13.34 MB
Publicly accessible
This dataset includes heat demand for potential application of direct use geothermal broken down into 4 sectors: agricultural, commercial, manufacturing and residential. The data for each sector are organized by county, were disaggregated specifically to assess the market demand ...
Authors
McCabe, K. et al National Renewable Energy Laboratory
geothermaldirect usethermal demandheat demandcommercialresidentialmanufacturingagriculturalusunited statesheat demand by sectorheat demand by countymccabegleasonreberyoungcharacterizationpotential applicationagriculturelow-templow-temperaturegeothermal vision studygeovision

Updated U.S. Low-Temperature Heating and Cooling Demand by County and Sector

Dec 31, 2022
22.73 MB
Publicly accessible
This dataset includes U.S. low-temperature heating and cooling demand at the county level in major end-use sectors: residential, commercial, manufacturing, agricultural, and data centers. Census division-level end-use energy consumption, expenditure, and commissioned power databas...
Authors
Oh, H. and Beckers, K. National Laboratory of the Rockies
geothermalenergythermal demandheating demandcooling demandlow-temperatureend-useresidentialcommercialmanufacturingagriculturaldatacenterdirect uselow temptemperaturecharacterizationfeasibilitygeospatial dataprocesssed dataexcel

Hourly Thermal Load Profiles for U.S. Manufacturing Subsectors

Apr 24, 2026
3.92 MB
Publicly accessible
This dataset includes a consistent framework of annual, quarterly, and hourly energy demand and operational profiles for 63 U.S. manufacturing subsectors defined by NAICS classification, building on the county-level demand dataset "Updated U.S. Low-Temperature Heating and Cooling ...
Authors
Oh, H. et al National Laboratory of the Rockies
geothermalenergythermal energy demandindustrial energy demandmanufacturingu.s. manufacturingnaicseia mecsqpchourly load profilesoperating schedulescapacity utilizationprocess heatingprocess coolingrefrigerationboiler usefacility heatingfacility coolingend-use energyfuel typeprocessed data

Utah FORGE: Pressure Temperature Logs from Blundell Well 71-10, Beaver County

Oct 08, 2018
52.5 kB
Publicly accessible
This archive contains an Excel spreadsheet with pressure and temperature logs from PacifiCorp well 71-10. This well is in the Blundell Power Plant geothermal well field near Roosevelt Hot Springs, Beaver County, Utah. The spreadsheet also contains UTM coordinates for the location ...
Authors
Foster, K. Energy and Geoscience Institute at the University of Utah
geothermalenergypressure/temperature logsutahutah forgewell 71-10roosevelt hot springsbeaver countygeothermal wellgeothermal well 71-10utpressuretemperatureblundell power planttraverse surveymilfordpacificorplogswelllogforge71-10blundellwell logresourcecharacterizationegswell datawell location

Gravity Survey on the Glass Buttes Geothermal Exploration Project Lake County, Oregon

Oct 12, 2011
1.19 MB
Publicly accessible
This report covers data acquisition, instrumentation and processing of a gravity survey performed on the Glass Buttes Geothermal Exploration Project, located in Lake County, Oregon for ORMAT Technologies Inc. The survey was conducted during 21 June 2010 to 26 June 2010. The surve...
Authors
Akerley, J. Ormat Nevada Inc
geothermaloregonglass buttesgravitygeophysicsgravity surveygravity datalake countyhat buttepotato lakedatareportorgps datasafetyenvironmental issuesimpact

Raft River Geothermal Area Logical and Fact Data Models

Jul 19, 2012
1.41 MB
Publicly accessible
This submission includes fact and logical data models for geothermal data concerning wells, fields, power plants and related analyses at Raft River, ID. The fact model is available in VizioModeler (native), html, UML, ORM-Specific, pdf, and as an XML Spy Project. An entity-relatio...
Authors
Cuyler, D. Sandia National Laboratories
geothermalraft rivercassia countyidahological modelfact modelwellfieldpower plantanalysisdata modelgeothermexus geothermalentity-relationshiperpdfviziomodelernativehtmlxmixmlumlclassattributepropertiesormxml spyprojecteditorconceptual modelerdspy project

Fallon, NV FORGE well 21-31 Lithology, Mineral, Image Log, and Injection Test data

May 30, 2020
3.47 MB
Publicly accessible
Attached is 5 datasets collected from Fallon FORGE well 21-31 located in Churchill County, Nevada collected and interpreted between Feburary 2018-January 2020. This submission includes 1) new lithology interpretation derived from petrographic thin sections of sidewall cores taken ...
Authors
Kraal, K. and Ayling, B. Sandia National Laboratories
geothermalenergyegsfallon forgefallonforgelithologyxrdx-ray diffractionhyperspectralformation microimagerfmiborehole televiewerbhtvimage logsinjection testnevadachurchill countysandia national laboratorieswell datawell 21-31

Appalachian Basin Play Fairway Analysis: Natural Sedimentary Reservoirs Data 2016 Revision

Dec 07, 2016
6.37 MB
Publicly accessible
Tier 3 data for Appalachian Basin sectors of New York, Pennsylvania and West Virginia used in a Geothermal Play Fairway Analysis of opportunities for low-temperature direct-use applications of heat. It accompanies data and materials submitted as Geothermal Data Repository Submissi...
Authors
Jordan, T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpirfcgpfa-abgeothermal play fairway analysiscontent modelgeologicnaturallow tempsedimentarycharacterizationutilizationlocationformationlithologyvolumeporositypermeabilityqualityassessmentresourcelow temperature

Geocellular model of St. Peter Sandstone for University of Illinois at Urbana-Champaign DDU Feasibility Study

Dec 31, 2018
68.79 MB
Publicly accessible
The geocellular model of the St. Peter Sandstone was constructed for the University of Illinois at Urbana-Champaign DDU feasibility study. Starting with the initial area of review (18.0 km by 18.1 km [11.2 miles by 11.3 miles]) the boundaries of the model were trimmed down to 9.7 ...
Authors
Damico, J. University of Illinois
geothermalenergyst. peter sandstoneillinois basinddudeep direct-useuniversity of illinois at urbana-champaign3-dgeocellular modelingfeasibilitycharacterizationillinois3dstructuralgeologymodelreservoirgeologicthermalhydrologicmechanicalpropertiespetrophysicalthermal conductivityspecific heat capacityheat capacityporositydensitypermeabilitythicknessdepthmt simon

Geocellular Model of Mt. Simon Sandstone for University of Illinois at Urbana-Champaign DDU feasibility study

Dec 31, 2018
111.49 MB
Publicly accessible
The geocellular model of the Mt. Simon Sandstone was constructed for the University of Illinois at Urbana-Champaign DDU feasibility study. Starting with the initial area of review (18.0 km by 18.1 km [11.2 miles by 11.3 miles]) the boundaries of the model were trimmed down to 9.7 ...
Authors
Damico, J. University of Illinois
geothermalenergygeocellular modelingmt. simon sandstoneillinois basinddudeep direct-use3-duniversity of illinois at urbana champaignfeasibilitycharacterizationillinoisstructuralgeologygeologicmodeldensityporositypermeabilitythermal conductivityheat capacitythicknessdepthst. peterthermalhydrologicmechanicalpetrophisicalproperties3dreservoir

New River Geothermal Exploration (Ram Power Inc.)

Nov 15, 2013
675.7 MB
Publicly accessible
The New River Geothermal Exploration (DOE Award No. EE0002843) is located approximately 25km south of the Salton Sea, near town of Brawley in Imperial County and approximately 150km east of San Diego, California. A total of 182 MT Logger sites were completed covering the two sepa...
Authors
Mirza, R. and Data, E. Ram Power, Inc.
geothermalmagnetotelluric surveymt surveyresistivitymesquitenew rivernorth americaimperial countyelectronic data exchangeedispacial modelspacial modelingsdmseismic reflection surveyfaultsbrawleycaliforniareportsite namesdaily survey notesparallel sensor testspatial modelingsurvey files1ddepth profilesresistivity models2d3ddepth plan mapsmapsgeosoftgeophysical modeling toolsgeotoolsgocadsoftwareappendixvibration monitoringsurvey notesgeospatial data

Rare Earth Element Concentrations from Wells at the Don A. Campbell Geothermal Plant, Nevada

Dec 09, 2016
731.5 kB
Publicly accessible
* Requires permission of originators for use. Rare earth element concentrations in thermal springs from the wells at the Don A. Campbell geothermal plant, Nevada. Samples taken from geothermal wells 85-11, 65-11, 54-11, and 64-11. Includes pH and concentrations for Cerium, Dyspros...
Authors
Fowler, A. and Zierenberg, R. University of California
geothermalnevadadon a. campbellrare earth elementsbrinereemineral countyconcentrationsaqueous chemistrythermal springsusgin content modelngds content modelcedyereugdholalundprsmtbtmyyb

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Project Red: Well 34A-22 Casing Integrity, Trajectory, Cement Bond, and Mudlog Data 2022

Jul 30, 2025
11.23 MB
Awaiting release
This dataset contains borehole logging data acquired in March-July 2022 from Fervo Energy geothermal wells in the Blue Mountain Geothermal Field, Humboldt County, Nevada. The submission includes casing inspection and cement evaluation logs, directional and trajectory measurements,...
Authors
Dadi, S. et al Fervo Energy
geothermalenergygeothermal wellswell loggingborehole loggingblue mountain geothermal fieldhumboldt countynevadafervoschlumbergerhalliburtonhorizonbm 34a24-23-22bm 34a31-23-22blue mountain 34alascasing inspectioncement bondacoustic cement evaluationtrajectory logsdirectional logsmudloglogsraw dataprocessed data

District Geothermal Energy Systems with Seasonal Underground Thermal Storage: Load Profiles, Modeling Workflow, and Techno-Economic Results for U.S. Screening

Sep 27, 2025
135.99 MB
Publicly accessible
This dataset accompanies the paper "Geothermal district energy systems coupled with seasonal underground thermal energy storage: a U.S. techno-economic screening by climate and geology." It contains the data and scripts required to reproduce the study's results across ten U.S. cit...
Authors
Mello, S. et al National Laboratory of the Rockies
geothermalenergydistrict energy systemsunderground thermal energy storageutesatesrtesground heat exchangerghesutratecho-economic analysisenergy modelingcomstockbuilding load profileslcoeaquifer storageseasonal storageu.s. citiespythonmodelscriptsmodel datasubsurface simulationgeotescold utes

Project Red: Monitoring Well 73-22 Geophysical and Mud Logging Data 2022

Jul 30, 2025
19.14 MB
Awaiting release
This dataset contains open-hole geophysical and mud logging measurements acquired in 2022 from Monitoring Well 73-22 in the Blue Mountain Geothermal Field, Humboldt County, Nevada. Data were collected by Baker Hughes, Baker Atlas, Horizon Well Logging, and other service providers ...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyblue mountainblue mountain geothermal fieldegsnevadahumboldt county73-22monitoring wellproject redgeothermal well logswell logsgeophysical loggingmud loggingacoustic slownesscompressional slownessshear slownessstoneley wavemonopole acousticdipole acousticazimuthal anistropygamma ray logresistivity logneutron porositydensity logcaliper logborehole conditionsbulk modulusshear modulusmechanical propertieslithologyalteration mineralsfracturesgas detectionlasraw dataprocessed datafervo

United States Geothermal Heat Pump Installations Database 2025

Sep 29, 2023
7.08 MB
Publicly accessible
This dataset documents U.S. geothermal heat pump (GHP) installations and was compiled as part of the 2025 Geothermal Market Report from the National Renewable Energy Laboratory (NREL). Records were sourced primarily from public drilling permits and include location information (ci...
Authors
Pauling, H. et al National Laboratory of the Rockies
geothermalheat pumpsghpinstallation databaseunited statesmarket report2025geothermal heat pumpground source heat pumpboreholedrilling permitsheating and coolingbuilding systemsprocessed datadatabaseborehole depthsystem capacitysystem configurationnumber of boreholes

Hawthorne Nevada Deep Direct-Use Feasibility Study 3D Seismic

Mar 29, 2018
467.07 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. et al Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduopendtectpstmprestack time migrationfault interpretationhawthornegeospatial data

Hawthorne Nevada Deep Direct-Use Feasibility Study Navy Geothermal Program Office General Data

Mar 29, 2018
693.88 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorne

SSGF Trace Element Concentrations

Jan 08, 2026
706.57 kB
Awaiting release
Presented are trace element concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is actively being studied as a source of geothermal brine for lithium extraction. ...
Authors
Kovalick, A. et al University of California Riverside
geothermaltrace elementssalton sea geothermal fieldrocksmineralhydrothermallithium valleygeothermal brineraw dataimperial countyssgfimperial valleyrare earth elementsreecritical mineralsmnznconibrine-rock reactionrock samplesbrine samplesrhyolitic domesdurmid hillsschmitt and hulenca 2-14wellschemistryfluid chemistrygeochemistrysalton sealithium extraction

SSGF Mineral Major Elements and Lithium Concentration

May 01, 2023
1.38 MB
Publicly accessible
Presented are major element and lithium concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is now being studied as a source of geothermal brine for lithium extr...
Authors
Humphreys, J. et al Lawrence Berkeley National Laboratory
geothermallithiummineralrockssalton sea geothermal fieldbrinelithium isotopteschloritegeologygeochemistryhydrothermalisotope quantificationextractionsalton sealithium valleygeothermal brineimperial countyraw data

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service