OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 180.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"3-component geophones"×
Document×

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

EGS Collab Experiment 1: Accelerometer orientations

Aug 19, 2020
608.24 kB
Publicly accessible
Document describing the methodology used to determine the accelerometers' three-component orientations at the first EGS Collab testbed using Continuous Active-Source Seismic Monitoring (CASSM) data and hodogram analysis. Original submission: gdr.openei.org/submissions/1166
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabmicroseismicsensor orientationaccelerometerorientationsurfsanford underground research facilityhydraulicfracturingexperimentstimulationmeso-scalemesoscalecrystalline rock3d sensorleadsouth dakotasta/lta triggering algorithmmicroseismicitypythongeospatial data3-ccassm datahodogram analysisprincipal component analysispcawellborewell datawell geometrybandpass filtercontinuous active-source seismic monitoringcassmthree-component

Snake River Plain Geothermal Play Fairway Analysis Project Active Source Seismic Data

Sep 30, 2018
5.99 GB
Publicly accessible
This archive contains seismic shot field records for 10 profiles located in Camas Prairie, Idaho. The eight numbered .sgy files were acquired using a seismic land streamer system with an accelerated weight drop source and 72 geophones. These 10-Hz geophones were mounted on base pl...
Authors
Liberty, L. and Shervais, J. Boise State University
geothermalenergypfaplay fairway analysisidahosrpsnake river plainseismicactive sourcedatageophysicsmapsurveygeophysicalcamasprairiesgygeologytopographyaerialgeologictopographicfairfield

HT Flash and Tantalum Capacitor Report

Oct 28, 2015
603.59 kB
Publicly accessible
Pushing the boundaries with geothermal tool development can often necessitate exceeding manufacturer specifications for temperature and pressure of individual circuit components. Detailed here are the efforts surrounding geothermal temperature characterization of commercially avai...
Authors
Cashion, A. and Cieslewski, G. Sandia National Laboratories
geothermalcomponent testinght componentsgeothermal toolscomponentselectronicshigh-temperaturehigh-temphigh temptool developmentflash memoryflashtantalumcapacitorhtdownholetemperaturepressurespecificationslimitationstechnologymanufacturer

Utah FORGE 3-2535: Report on Borehole EM Data Collection and Imaging with the VEMP Field System

Sep 05, 2024
7.81 MB
Publicly accessible
This report outlines electromagnetic field measurements that were made after stimulation at Utah FORGE in May of 2024. The measurements involved lowering an electrode to ~3500' in well 16A to energize the steel casing as part of the electric source, with the return electrode locat...
Authors
Alumbaugh, D. et al Lawrence Berkeley National Laboratory
geothermalenergyelectromagneticresistivityutah forgeegs16aemvempgeophysicsborehole loggingcross-boreholemagnetic inductionthree componentstimulationreportdata collectiondata processing

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

WHOLESCALE: Seismic Survey Metadata from San Emidio Nevada 2021

Apr 06, 2021
25.39 MB
Publicly accessible
This is a collection of metadata from the 2021 seismic survey at the San Emidio geothermal field in Nevada. In April and May 2021, 37 tri-axial short period seismographs were deployed in a 1.8km diameter cluster centered on 40.367278 deg N, 119.409019 deg W. The first data record...
Authors
Lord, N. et al Department of Geoscience University of Wisconsin-Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadasmartsolodatacubedldsacsan emidiogeophysicssurvey designpythondata processingpumping

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Curated
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs

WHOLESCALE: Seismic Survey Data from San Emidio Nevada 2021

Apr 06, 2021
1.67 TB
Publicly accessible
This dataset includes raw and processed seismic data from the 2021 seismic survey at the San Emidio geothermal field in Nevada. In April and May 2021, 37 tri-axial short period seismographs were deployed in a 1.8km diameter cluster centered on 40.367278 N, 119.409019 W. The first...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsacraw dataprocessed datageophysicssiesmic datasmartsolodatacubeseismographdata lakesan emdidionevadapumpingtri-axialdld

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Developing Successful Exploration Strategies in Extended Terranes

Dec 31, 2013
7.07 MB
Publicly accessible
We conducted a comprehensive analysis of the structural controls of geothermal systems within the Great Basin and adjacent regions. Our main objectives were to: 1) Produce a catalogue of favorable structural environments and models for geothermal systems. 2) Improve site-specifi...
Authors
E., J. University of Nevada
geothermalstructural controlsgreat basinquaternary faultswalker lanesouthern cascadespotential for developmentsubsurfacegeologykinematic analysisstress determinationgravitygravity surveygeophysicsgeophysicalslip tendancy3d modelingtectonic settingdrill sitedrill site selection

Utah FORGE 3-2535: Building a 3D Resistivity Model for Simulation and Survey Design of EM Measurements

Dec 01, 2022
3.23 MB
Publicly accessible
The included report outlines the creation of three 3D resistivity models that will be used to determine the sensitivity of EM measurements for the hypothetical stimulated reservoir at FORGE as well as for EM survey design. FORGE project 3-2535 is planning on using a casing source ...
Authors
Alumbaugh, D. et al Lawrence Berkeley National Laboratory
geothermalenergyutah forgeegsforgemodelingresistivity modelremote sensingwell characterizationwell 16awell 16b

Three-Component Long Offset Surface Seismic Survey Data Used to Find Large Aperture Fractures in Geothermal Resources San Emidio Geothermal Resource Area

Sep 15, 2010
794.98 MB
Publicly accessible
P and S-wave datasets and associated report studying the ability to use three-component long offset surface seismic surveys to find large aperture fractures in geothermal resources at the San Emidio geothermal resource area in Washoe County, Nevada.
Authors
Warren, I. U.S. Geothermal Inc.
geothermalsan emidiofracture apertureseismic surveyp-wave datas-wave datareportfracture detectionwashoe countynevadadatas-wavep-waveseismic data processingnvvibroseisactive sourcesweep

Utah FORGE: Borehole PSS Tools Status Report

Dec 29, 2022
6.52 MB
Publicly accessible
This report summarizes the data quality from the Utah FORGE borehole passive seismic sensors (PSS) tools at well sites 58-32 and 78B-32. Two level Avalon tools were installed on 09-28-2022 and 09-29-2022 by representatives from Avalon, Schlumberger, University of Utah, and Instrum...
Authors
Stachnik, J. Instrumental Software Technologies, Inc.
geothermalenergyutah forgeseismic sensorsseismicseismicityborehole seismic sensorsborehole passive seismic sensorspsspassive seismic sensorsseismic sensing tools

Utah FORGE 2-2439v2: A Multi-Component Approach to Characterizing In-Situ Stress Final Report

Dec 22, 2025
2.43 MB
Curated
This comprehensive technical report documents a multi-component approach to in-situ stress characterization at the Utah FORGE EGS site that integrates Machine Learning (ML) methods for predicting near-well principal stresses around geothermal wells with the physics-based finite el...
Authors
Bunger, A. et al University of Pittsburgh
geothermalenergyin-situ stress estimationutah forgewave velocitythermo-poro-elastic modelingmachine learningegsnear-wellbore stressfar-field principal stressstress anisotropyphysics-based modelingfinite element modelingsonic logtuvtechnical reportreservoir characterization

Utah FORGE 2439: A Multi-Component Approach to Characterizing In-Situ Stress

Dec 13, 2022
201.16 MB
Publicly accessible
Core-based in-situ stress estimation, Triaxial Ultrasonic Velocity (labTUV) data, and Deformation Rate Analysis (DRA) data for Utah FORGE well 16A(78)-32 using triaxial ultrasonic velocity and deformation rate analysis. Report documenting a multi-component approach to characterizi...
Authors
Bunger, A. et al Battelle Memorial Institute
geothermalenergyutah forgein-situ stresslaboratorymodelingfield measurementtuvtriaxial ultrasonic velocitydeformation rate analysisdraweight of evidencewoeegsstress testcharacterizationwell datageophysicsforge16a78-32

Utah FORGE 2-2439v2: A Multi-Component Approach to Characterizing In-Situ Stress 2025 Workshop Presentation

Sep 18, 2025
70.04 MB
Curated
This is a presentation on A Multi-Component Approach to Characterizing In-Situ Stress at the U.S DOE FORGE EGS Site: Laboratory, Modeling and Field Measurement project by University of Pittsburgh, presented by Dr. Andrew Bunger. The project's objective was to characterize stress i...
Authors
Bunger, A. University of Pittsburgh
geothermalenergyutah forgeegsin-situ stresscharacterizationstress modelinglaboratory testingmachine learningsonic loganalysismini-frac testing2025 annual workshoppresentationpresentation recordingpresentation slidesreport

EGS Collab Experiment 1: Microseismic Monitoring

Jul 29, 2019
3.55 GB
Curated
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsmicroseismic monitoringmeso-scale stimulationssandford underground researchmesoscale experimentscrystalline rock3d sensorleadsouth dakotasta/lta triggering algorithmmicroseismicitycatalograw dataprocessed databinary file interpreterpythongeospatial data

Electronics Platform and Temperature Sensor System For Enhanced Geothermal Systems Capable of 300C

Jan 01, 2012
293.43 kB
Publicly accessible
Final research performance report for an electronics platform and temperature sensor system for enhanced geothermal systems (EGS) capable of 300 degrees Celcius.
Authors
Vert, A. GE Global Research
geothermalsensordown-holehigh temperaturesilicon carbideelectronicsceramicoperational amplifiercomponentprototypeoscillator300cegs

Utah FORGE: Phase-Picking Based Microseismic Event Catalog April 2024 Stimulation

Feb 19, 2026
1.73 MB
Curated
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a phase-picking workflow that integrates downhole geophones (wells 56 and 78B) and downhole DAS (well 16B). P and S-wave arr...
Authors
Zhu, W. et al University Of Utah
geothermalenergyapril 2024 stimulationforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationhydraulic fracturinggeomechanicsgeophysics

A Thermal-Hydrological-Chemical Model for the EGS Demonstration Project at Newberry Volcano, OR

Jan 30, 2012
Size unavailable
Publicly accessible
Newberry Volcano in Central Oregon is the site of a Department of Energy funded Enhanced Geothermal System (EGS) Demonstration Project. Stimulation and production of an EGS is a strong perturbation to the physical and chemical environment, giving rise to coupled Thermal-Hydrologic...
Authors
Sonnenthal, E. et al National Energy Technology Laboratory
geothermalnewberryoregonegsenhanced geothermal systemnewgenthermalhydrologychemicalmodelcross-sectionsstimulationinjectionhydrologicaldemonstrationmechanical

Low-Temperature Geothermal Geospatial Datasets: An Example from Alaska

Feb 06, 2023
242.5 MB
Curated
This project is a component of a broader effort focused on geothermal heating and cooling (GHC) with the aim of illustrating the numerous benefits of incorporating GHC and geothermal heat exchange (GHX) into community energy planning and national decarbonization strategies. To bet...
Authors
Davalos Elizondo, E. et al National Renewable Energy Laboratory
geothermalenergylow temperaturegeothermal resourcesdatasetheat flowthermal conductivitybottom-hole temperaturegeoreportrsatheat pumpghpgeothermal heat exchangelow tempgeologygeophysicsoil and gaswellgeospatial dataghcghxgeothermal heating and coolingalaskaresearch size assessment tool

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Curated
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service