OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 71 of 71.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"in-situ"×
Image×

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Reservoir Stimulation Optimization with Operational Monitoring for Creation of EGS

Sep 25, 2013
65.42 MB
Publicly accessible
EGS field projects have not sustained production at rates greater than half of what is needed for economic viability. The primary limitation that makes commercial EGS infeasible is our current inability to cost-effectively create high-permeability reservoirs from impermeable, igne...
Authors
A., C. Pacific Northwest National Laboratory
geothermalfracturing fluidmonitoringxmtnmracousticrheologypermeabilityegsigneous rock

Utah FORGE: Wells Updated Temperature and Pressure Logs (June 2021)

Jun 29, 2021
3.25 MB
Publicly accessible
This dataset includes updated temperature and pressure logs for Utah FORGE wells 56-32, 78-32, and 58-32. This data was acquired in June 2021.
Authors
Stout, F. Di Drill Survey Services
geothermalenergyutah forgewelllogstemperature pressure logswell 58-32well 56-32well 78-32temperaturepressuredataraw dataprocessed datautahforgeegs

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

Assessing Low-Temperature Geothermal Play Types: Relevant Data and Play Fairway Analysis Methods

Jan 01, 2023
17.19 MB
Publicly accessible
This data catalog contains information on low temperature geothermal play types. The U.S. Department of Energy (DOE) Geothermal Technologies Office (GTO) supports the Geothermal Heating and Cooling Geospatial Datasets and Analysis project, conducted by the National Renewable Energ...
Authors
Davalos, E. et al National Renewable Energy Laboratory
geothermalenergylow-temperaturedatasetsgeothermal heating and coolingdata cataloglow temperaturegeospatialgeochemicalprocessed datageophysicaleconomic riskdata repositoryplay fairway analysisplay fairwayalaskahawaiiunited statesexploration risktechnical reportreport

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

West Flank Coso, CA FORGE Test Area

Nov 15, 2015
773.24 kB
Publicly accessible
A map with the Coso West Flank FORGE test area outlined, along with regional seismicity, the aeromagnetic data set and the area currently being utilized for the creation of the 3D model.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankforgegeographygeophysicscaliforniacososeismicityaeromagnetic

REopt Lite Geothermal Heat Pump Design Requirements

Mar 08, 2021
277.13 kB
Publicly accessible
This document describes the design requirements for the geothermal heat pump (GHP) module being added to the existing REopt Lite web tool. This document describes the purpose, users, and functional requirements to which the modified web tool shall conform. This document will be re...
Authors
Olis, D. National Renewable Energy Laboratory
geothermalenergyreoptreopt liteghpgeothermal heat pumpmodelmoduleweb toolweb interfacetooltechno-economiceconomics

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

DCIF Westerly Granite AE Stress Effect Test (Task 3-1)

Jul 08, 2021
216.62 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on rectangular Westerly granite blocks (width=depth=4.0", height=2.0"). Liquid nitrogen was poured in a small, 1"-diameter copper cup attached to the top of the sample, and the resulting acoustic emissions (A...
Authors
Nakagawa, S. and Trzeciak, M. Lawrence Berkeley National Laboratory
geothermalenergythermal fracturingstress measurementfracturingprocessed datageophysicsstress testinggranitewesterly granitestressmicrofracturefracturedatatemperatureacoustic emissionacoustic emission locationacoustic emission rate

EGS Collab Experiment 2: Core Logs

Jul 08, 2019
1.36 GB
Publicly accessible
Core logs and photos from the EGS Collab project Experiment 2 for the Top Vertical well (TV4100) and the Top Horizontal well (TV 4100) on the 4100 Level of SURF (the Sanford Underground Research Facility). The core logs are stored in a single PDF file with 5-ft run intervals. In t...
Authors
Dobson, P. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegscore logcorefoldingfoliationwell datalogging

Walker Ranch 3D Seismic Images

Mar 01, 2016
836.05 kB
Publicly accessible
Amplitude images (both vertical and depth slices) extracted from 3D seismic reflection survey over area of Walker Ranch area (adjacent to Raft River). Crossline spacing of 660 feet and inline of 165 feet using a Vibroseis source. Processing included depth migration. Micro-earthqua...
Authors
J., R. Lawrence Livermore National Laboratory
geothermal3d seismic reflectionwalker ranchraft river3d seismicdepth slicenarrowsmeqmicroseismicitygeophysicsegsnarrows zoneactive source

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Project HOTSPOT: Kimberly Well Core Photos

Jun 16, 2011
944.97 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalkimberlyproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data

Play Fairway Analysis CA-NV-OR: Additional 2km Grid Figures

Aug 05, 2015
21.36 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area. Grids at 2km, updated from 5km.
Authors
Ferguson, C. University of California
geothermaldegree of explorationheat flowdata differencemedicine lakesan emidiopermeabilitypfageologic profilerasterjpeggeoreferencedgeospatial dataheatrankca-nv-orplay fairway analysischaracterizationexplorationcalifornianevadaoregon

Lost Circulation Materials in Geothermal Drilling: Single Fracture Clogging Experments

Jan 06, 2025
9.9 MB
In progress
The submitted dataset was generated by a series of laboratory fracture clogging (permeability reduction) experiments using commercially available materials used for lost circulation management during geothermal well drilling. The experiments were conducted using a permeability plu...
Authors
Lawrence Berkeley National Laboratory
geothermalenergydrillinglost circulation managementlost circulation materialsfractureclogginglaboratory experiment

Project HOTSPOT: Mountain Home Well Core and Drill Site Photos

Jan 11, 2012
937.4 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoyellowstone hotspotproject hotspotborehole geophysicsmountain homedrillingphoto core logdownhole geophysicsphotossrpcontinuous volcanismcore samplecore logwell datacore

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Renewable Energy Potential Model: Priority Geothermal Leasing Areas ReEDs Results

May 20, 2024
859.13 kB
Publicly accessible
This dataset contains the results of a study conducted by the National Renewable Energy Laboratory (NREL) to identify potential future priority geothermal leasing areas on Bureau of Land Management (BLM) and United States Forest Service (USFS) lands. The analysis uses the Regional...
Authors
Smith, F. et al National Renewable Energy Laboratory
geothermalenergyreedsgamspythonblmusfsrenewable energy potential modelgeothermal leasing areaspriority leasingresource potentialfeasibilitytechnology combinationnatural resource conflictstransmissiongeothermal capacitygenerationsystem costemissionstechnical reportprocessed datamodelinggithubmodel results

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Project HOTSPOT: Kimama Well Core and Drill Site Photos

Jan 16, 2011
106.28 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainkimamaphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data
<< Previous123
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service