OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 14 of 14.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"fault interpretation"×
Image×

DEEPEN 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jun 30, 2023
3.62 GB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. Part of the DEEPEN project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfamodellingmodelingcharacterizationexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponent

Simulations of Brady's-Type Fault Undergoing CO2 Push-Pull: Pressure-Transient and Sensitivity Analysis

Mar 09, 2018
9.74 MB
Publicly accessible
Input and output files used for fault characterization through numerical simulation using iTOUGH2. The synthetic data for the push period are generated by running a forward simulation (input parameters are provided in iTOUGH2 Brady GF6 Input Parameters.txt [InvExt6i.txt]). In gene...
Authors
Jung, Y. and Doughty, C. Lawrence Berkeley National Laboratory
geothermalenergyegsco2carbon dioxidepush-pullpressure-transient testingitough2sensitivity analysisinverse modelingparameter estimationinconpesttough2fault modelinggf6bradyfaultingfaultfracturecharacterizationstimulation

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Curated
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Utah FORGE: Targeting Geothermal Resources with Geodetic Strain Data Paper

Oct 01, 2004
Size unavailable
Publicly accessible
The paper linked below offers an initial assessment of a new method to target potential geothermal resources on the regional scale. The method is based on seeking relationships between geologic structures and geodetic observations of regional tectonic strain.
Authors
Blewitt, G. et al Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgestraingreat basin strainegsgeodetictensorsecond invariantgeodesynevadautahratecrustalgpsfaultorientationmagnitude

Utah FORGE: Optimization of a Plug-and-Perf Stimulation (Fervo Energy)

Feb 08, 2023
6.91 MB
Publicly accessible
Information around the plug-and-perf treatment design at Utah FORGE by Fervo Energy. Objective and Purpose: Develop a multistage hydraulic stimulation approach designed specifically to target the top three factors that control the technical and commercial viability of an EGS sys...
Authors
Norbeck, J. et al Fervo Energy
geothermalenergyutah forgeplug-and-perf stimulationwell stimulationfervo energyplug-and-perfplug and perffervotechnicalassessmentfeasibilityhydraulicstimulationinjection testprocessed datablue mountainnevadaegswell 73-22well 34a-22well 34-22near-field egshorizontal drillingproppantheat in placestate of stressfiber optic sensing

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Curated
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Curated
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

EGS Collab Experiment 2: Continuous Broadband Seismic Waveform Data

Sep 12, 2022
17.77 MB
Curated
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. This dataset includes the NSF SAGE website where seismic waveform data from this experiment can be downloaded. Two broadband seismometers were installed...
Authors
Rodriguez Tribaldos, V. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegswaveformsbroadbandtiltcharacterizationseismicwaveformgeophysicsexperiment 2continuousmonitoring4100 level

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Curated
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Utah FORGE: Fluid Injection Induced Shearing Experiments on Fractured Granitoid at Elevated Temperatures

Aug 12, 2024
80.21 MB
Publicly accessible
This repository contains experimental data from a series of fluid injection-induced shearing tests conducted on Utah FORGE granitoid. The experiments were performed using an aluminum triaxial pressure vessel (TEMCO) apparatus at Pennsylvania State University. The primary aim was t...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergytemperatureexperimentpre-stressseismicityutah forgeegsgranitoidtemcotriaxial pressure vesselfault seismicitypre-stress ratioshearpore pressure60-gritinclined fracture

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Curated
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service