OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 99.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"12-27"×

Salton Sea Fluid Inclusion Gas Analysis

Jan 01, 2013
4.06 MB
Publicly accessible
Fluid inclusion gas analysis for wells in Salton Sea geothermal area, California. Analyses used in developing fluid inclusion stratigraphy for wells and defining fluids across the geothermal fields. Each sample has mass spectrum counts for 180 chemical species.
Authors
Dilley, L. Hattenburg Dilley and Linnell
geothermalfluid inclusiongas analysisfluid inclusion stratigraphymass spectrometrysalton seasedimentaryimperial valleycalifornia

Utah FORGE: Earthquake Catalog

Mar 21, 2018
66.71 kB
Publicly accessible
This is the set of earthquake catalogs developed for the Utah FORGE project covering December of 2016 through March of 2018. These are discussed in the "Utah FORGE Phase 2B Final Topical Report," which can be found on GDR under id: 1038 (See link 'Final Topical Report' in resource...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge seismicityseismicityearthquakeearthquakesgeospatial dataearthquake catalogsutah forge earthquake catalogsutahutah forgeutah forge 2broosevelt hot springsmilfordforgephase 2bmicroseismicitymonitoringseismicmicroseismicegsprocessed datareportcatalogresourcecharacterization

Utah FORGE: Seismicity Associated with the 2019 Well 58-32 Stimulation

Apr 30, 2019
10.18 kB
Publicly accessible
This catalog describes the seismicity associated with the 2019 stimulation at Utah FORGE. Containing both matched-filter detections (Dzubay et al., 2022) and Schlumberger-recorded events (detected with a 12-level geophone string), the final combined catalog contains a total of 534...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forge58-32 stimulation2019 stimulation58-32 seismic datautah forge seismicity58-32 stimulation seismicityseismicitymicroseismiceventmicroseismicitywellwell 58-32stimulationraw datawell depthdepthmagnitudeutah

EGS Collab Experiment 1: Microseismic Monitoring

Jul 29, 2019
3.55 GB
Curated
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsmicroseismic monitoringmeso-scale stimulationssandford underground researchmesoscale experimentscrystalline rock3d sensorleadsouth dakotasta/lta triggering algorithmmicroseismicitycatalograw dataprocessed databinary file interpreterpythongeospatial data

Garner Valley DAS Metadata

Sep 10, 2013
21.69 kB
Publicly accessible
Metadata for the data collected at the NEES@UCSB Garner Valley Downhole Array field site on September 10-12, 2013 as part of the larger PoroTomo project.
Authors
Lancelle, C. University of Wisconsin
geothermaldistributed acoustic sensingfiber opticsporotomogarner valleydownhole arraymetadata

Utah FORGE: Updated Phase 2C Well Location Coordinates

Dec 07, 2020
16.48 kB
Publicly accessible
Utah FORGE has been established to develop, test, and improve the technologies and techniques required to develop EGS-type geothermal resources. Drilling of the first of two deep deviated wells, 16A(78)-32, will begin in the second half of 2020. This well will serve as the injecti...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeforgewell 56-32 locationwell 68-32 locationwell 78-32 locationutah forge phase 2gpsegsroosevelt hot springsmilfordgeospatial datagisshapefileutah geological surveywell dataphase 2cwell locationswell location

Lightning Dock Geothermal Field Data Package, Hidalgo County, New Mexico

Aug 19, 2026
7.4 GB
Curated
This submission is a curated geoscience, well and plant-operations data package for the Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico, a liquid-dominated system produced for binary (ORC) power generation. It covers well-by-well data...
Authors
Ifrene, G. et al Zanskar Geothermal
lightning dockwell logsgisproduction datageothermalenergytracer testpower generationgeochemistrygeophysicsgroundwaterbinary systemorcdownhole temperaturebouguermagnetotelluricinversion modelsaeromagneticsgravity surveylidarquaternary faultgeologymud logstemperature

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

PoroTomo: BRAD and BRDY GPS Station RINEX Files December 20, 2014

Dec 20, 2014
394.45 kB
Publicly accessible
This dataset provides links to daily RINEX files for two GPS stations at Brady's Hot Springs as of December 20, 2014. The data is formatted as compressed GNSS RINEX observation files and is accessible through CSV files containing metadata such as file size, data type, and publicat...
Authors
Kreemer, C. University of Nevada
geothermalgeodesygpsrinexgeospatial databradbrdybrady hot springsbradys hot springsftp locationporotomobradyfieldnevadaunavcohydrothermalcsv

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Energy Return On Investment of Engineered Geothermal Systems Data

Jan 01, 2012
1.05 MB
Publicly accessible
The project provides an updated Energy Return on Investment (EROI) for Enhanced Geothermal Systems (EGS). Results incorporate Argonne National Laboratory's Life Cycle Assessment and base case assumptions consistent with other projects in the Analysis subprogram. EROI is a ratio o...
Authors
Mansure, C. Arthur Mansure
geothermalenergyinvestmentreturnpaybackengineeredenergy return on investmentengineered geothermal systemenhanced geothermal systemefficiencyegseroicasingcementdiameterdepthgeteminputswellsnettruckingfuelmaterialsbentonitepolymerseconomicsassessmenteconomic

Brady's Geothermal Field Reftek Seismometer Data

Mar 30, 2016
Size unavailable
Publicly accessible
Continuous seismic recordings from six Reftek seismometers deployed at Bradys Hot Springs geothermal field in Nevada from March 9th to 30th, 2016. Data is archived in mseed format. Five of the six stations are under a moratorium.
Authors
Feigl, K. University of Wisconsin
geothermalporotomopassive seismicbradys hot springsnevadareftekseismometerseismicarraybradyseismicitymonitoringnvpassive source

Evaluation Data of a High Temperature COTS (Commercial Off-the-Shelf) Flash Memory Module (TI SM28VLT32) for Use in Geothermal Electronics Packages

Aug 29, 2014
284.53 MB
Curated
The accompanying raw data is from tests of the TI SM28VLT32 flash memory module at temps of 200C, 225C, and 29C. Each data file is 3 columns and tab-delimited with the first column being the data address, the second column being the first byte of the data, and the third column bei...
Authors
Cashion, A. Sandia National Laboratories
geothermaldownhole electronicscomponent evaluationborehole temperaturesmemoryevaluation datahigh temperaturecots flash memory modelelectronicsflash memory moduleti sm28vlt32

Utah FORGE: Borehole PSS Tools Status Report

Dec 29, 2022
6.52 MB
Publicly accessible
This report summarizes the data quality from the Utah FORGE borehole passive seismic sensors (PSS) tools at well sites 58-32 and 78B-32. Two level Avalon tools were installed on 09-28-2022 and 09-29-2022 by representatives from Avalon, Schlumberger, University of Utah, and Instrum...
Authors
Stachnik, J. Instrumental Software Technologies, Inc.
geothermalenergyutah forgeseismic sensorsseismicseismicityborehole seismic sensorsborehole passive seismic sensorspsspassive seismic sensorsseismic sensing tools

Tularosa Basin Play Fairway Analysis: Strain Analysis

Nov 15, 2015
32.91 kB
Publicly accessible
A DEM of the Tularosa Basin was divided into twelve zones, each of which a ZR ratio was calculated for. This submission has a TIFF image of the zoning designations, along with a table with respective ZR ratio calculations in the metadata. The primary results are in the table belo...
Authors
Brandt, A. University of Utah
geothermalzr ratiostrainanalysistularosabasinnew mexicotexasexplorationzrratiostrain rate

Processed Lab Data for Neural Network-Based Shear Stress Level Prediction

May 14, 2021
6.01 MB
Publicly accessible
Machine learning can be used to predict fault properties such as shear stress, friction, and time to failure using continuous records of fault zone acoustic emissions. The files are extracted features and labels from lab data (experiment p4679). The features are extracted with a n...
Authors
Marone, C. et al Pennsylvania State University
geothermalenergymatlabgeophysicsseismiccodeprocessed datamicroseismicityaiartificial intelligencedeep learningmachine learningacousticsacoustic emissionsseismic forcastingseismic predictionfaultfault propertiesshear stresstime to failureexperimentexperimental datalab databiaxial shear experimentbiaxial shear apparatusfriction

PoroTomo: BRAD and BRDY GPS Station RINEX Files March 26, 2015

Jan 01, 2015
49.48 kB
Curated
This dataset provides links to daily RINEX files for two GPS stations at Brady's Hot Springs as of March 26, 2015. The data is formatted as compressed GNSS RINEX observation files, accessible through formatted CSV files, as well as in links to the complete daily time series data. ...
Authors
Kreemer, C. University of Wisconsin
geothermalgeodesygpsbrady hot springbrady hot springsrinexftp locationporotomobradyfieldnevadabradbrdybradys hot springshydrothermal

Newberry EGS Seismic Velocity Model

Oct 01, 2013
4.2 MB
Publicly accessible
We use ambient noise correlation (ANC) to create a detailed image of the subsurface seismic velocity at the Newberry EGS site down to 5 km. We collected continuous data for the 22 stations in the Newberry network, together with 12 additional stations from the nearby CC, UO and UW ...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsvelocityreservoirseismic velocitycross-correlationmodelgeophysicsnewberry

Utah FORGE: Phase 3 Ground Water Level Monitoring Data

Sep 30, 2020
17.28 MB
Publicly accessible
Groundwater data around the Utah FORGE site has been collected to determine the piezometric levels and compositional variability. Field measurements in 2020 are designed to obtain and survey new groundwater wells that have been drilled on the distal periphery of the Utah FORGE pro...
Authors
Kirby, S. Utah Geological Survey
geothermalenergyground waterground water levelwater levelutah forgeforgewow-2wow-3well datatemperaturecorrectedwater elevationgroundwaterroosevelt hot springsmilfordegswater table depthmonitoring

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Utah FORGE: Source Imaging DAS-Based Seismic Event Catalog April 2024 Stimulation

Aug 26, 2025
140.41 kB
Curated
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a DAS-specific source imaging workflow that avoids conventional phase picking. Instead, STA/LTA-transformed DAS and downhole...
Authors
Dvory, N. et al The University Of Utah
geothermalenergyforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationapril 2024 stimulation

Utah FORGE: X-Ray Diffraction Data

Feb 07, 2018
96.91 kB
Publicly accessible
This dataset contains X-ray diffraction (XRD) data taken from wells and outcrops as part of the DOE GTO supported Utah FORGE project located near Roosevelt Hot Springs. It contains an Excel spreadsheet with the XRD data, a text file with sample site names, types, and locations in ...
Authors
Nash, G. and Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyx-ray diffractionxrdutah forgeforgeutahroosevelt hot springsmineralogylithologyxrayutshapefilegeospatial dataarcgiscrystallographycrystalline mineralswell dataoutcropgeochemistryegsmilfordresourcecharacterization

Directional Cooling-Induced Fracturing: Directional Cooling Data Under True-Triaxial Stress State

Jul 01, 2022
1.96 GB
Publicly accessible
Data includes Directional Cooling-Induced Fracturing (DCIF) testing data using westerly granite blocks. This submission includes data from two samples of westerly granite, lab sample 7 and 8. Files contain stress, temperature and acoustic emission data acquired during polyaxial, l...
Authors
Trzeciak, M. University of Wisconsin Madison
geothermalenergystressstress testacoustic emissionaetriaxialtrue-triaxialdirectional coolinggranitewesterly granitesamplerocktestingtestdirectional cooling induced fracturingdciffracturingfailure

Utah FORGE: Area 0.5 m LiDAR Data

Oct 01, 2016
Size unavailable
Publicly accessible
During the Fall of 2016 AGRC and the Utah Geological Survey acquired ~205 square miles of 8 points per meter Quality Level 1 LiDAR of The Frontier Observatory for Research in Geothermal Energy (FORGE) area around Milford, Utah in Beaver and Millard Counties in western Utah. The 0....
Authors
Allis, R. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgedemdsmdigital elevation modeldigital surface modelegsenhanced geothermal systemsfrontier observatory for research in geothermal energyroosevelt hot springsutlidargeospatial datagisremote sensingutahdatamilford

Calculation Tool for Transported Geothermal Energy Using Two-Step Absorption Process

Feb 01, 2016
24.33 kB
Publicly accessible
This spreadsheet allows the user to calculate parameters relevant to techno-economic performance of a two-step absorption process to transport low temperature geothermal heat some distance (1-20 miles) for use in building air conditioning. The parameters included are (1) energy de...
Authors
Liu, X. et al Oak Ridge National Laboratory
geothermalabsorptionlow temperaturecalculation toolcommercial building conditioningcalculatorabsoptionlow tempaeraturetoolenergy densitytransportation costequipment costpublic reportlow tempeconomicsfeasibilitytechnicalcommercialconditioning
<< Previous1234Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service