OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 278.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"Roosevelt Hot Spring"×

Utah FORGE: Well 82-33 Logs and Data, Roosevelt Hot Spring Area

Mar 03, 2016
74.2 MB
Publicly accessible
This is a compilation of logs and data from Well 82-33 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgeutah egsroosevelt hot springgeothermal well logswell logsutah well logsgeothermal wellsutah geothermal wellsroosevel hot springbottom hole pressurecasing schematiccleanoutsdirctional surveygeochemistrygeology loginjection cpaacitymorning reportsplan of operationsspinner surveyinjection testwater analysiswater chemistrycompensated soniccalipercement bondcollar logcompensated neutronformation densitydifferential temperaturegamma raymud loginductionpressure surveytemperature surveywell logwell data82-33utahresourcecharacterizationmilfordroosevelt hot springs

Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
97.37 MB
Publicly accessible
This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egsroosevelt hot springutah geothermal wellswell logsutah well logsutah geothermalgeothermal well logsroosevelt hot springswater analysiswater qualitygeochemistryflow samplewireline samplepressure surveytemperature surveysubsurfacehistorywell schematicsite mapwell locationscasing schematicwell completionbhtgradienthydrothermal alterationcompensated soniccompensated neutronformation densityporositylaterlogdual inductionelectromagneticelectro-magneticthickness toolfracture identificationmud logcaliperboreholedownholegeophysicssurveygeophysicalgeochemicalwell datautah52-21well logresourcecharacterizationmilford

Utah FORGE: Well Acord 1-26 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
91.14 MB
Publicly accessible
This is a compilation of logs and data from Well Acord 1-26 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Logs include: mud log (45'-12645'), compensated densilog (1102'-7923', 7900'-12644'), neutron log (1102'-7923'), dual induction ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egswell logsutah well logsgeothermal wellsutah geothermal wellsroosevelt hot springsroosevelt hot springcement bondgamma rayneutronporositycompensated densilogstratigraphic reportstratigraphypetrographydual inductionacousticacoustilogdensitytemperature logdifferentialsamplegeothermcalipermud logdrillers logwater rightspermission to drilldrilling planbond documentsacordutahacord 1-26well logwell dataresourcecharacterizationmilfordtemperaturedensilogcompensatedcuttings

Utah FORGE: Well 14-2 Logs and Data from Roosevelt Hot Spring Area

Mar 03, 2016
96.02 MB
Publicly accessible
This is a compilation of logs and data from Well 14-2 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Data includes: flowmeter survey (1989), geochemistry (1977-1978, 1977-1983), injection test data (1979, 1982), and spinner surveys (19...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermal wellsutah well logswell logsgeothermal wellsgeothermal well logsutah egsgeophysicsdownholeboreholemud logspinner surveyinjection testgeochemistryflowmeter testsonicgammaporositytemperaturepressuresurveysubsurfaceinductioncalipercompensated neutronformation densityutahwell datawell log14-2resourcecharacterizationmilfordroosevelt hot springsflowmeterspinnergamma raycompensatedneutronformationdensityelectricsteam injection

Structural Inventory of Great Basin Geothermal Systems and Definition of Favorable Structural Settings

Dec 31, 2013
244.5 kB
Publicly accessible
Structural controls of 426 geothermal systems in the Great Basin region including western Nevada, central Nevada, northwestern Nevada, northeastern Nevada, east-central Nevada, eastern California, southern Oregon, and western Utah were analyzed with literature research, air photos...
Authors
Faulds, J. University of Nevada
geothermalquaternary faultsstructural controlsblind geothermal systemstemperaturegeothermometryfield visitswestern nevadacentral nevadanorthwestern nevadanortheastern nevadaeast-central nevadaeastern californiasouthern oregonwestern utahutahnevadaoregoncaliforniabaltazor hot springblue mountainbog hot springdyke hot springshoward hot springmacfarlane hot springmcgee mountainpinto hot springsbeowawecrescent valleyhot springs pointdann ranchhand-me-down hot springsgolcondapumpernickel valleytipton hot springsash springschimney hot springduckwaterhiko hot springiverson springmoon river hot springmoorman springrailroad valleywilliams hot springwalleys hot springantelope valleyfales hot springsbuckeye hot springstravertine hot springsteels marshrhodes marshcolumbus marshalum-silver peakfish lake valleygabbs valleywild roserawhide-wedell hot springsalkali hot springsbaileys/hicks/burrell hot springsalvord hot springbaileys hot springburrell hot springhicks hot springantelope hot springhart mountainborax lakecrump geysermickey hot springnewcastleveyo hot springdixie hot springthermorooseveltcove fortred hill hot springjoseph hot springhatton hot springabraham-baker hot springsgreat basinhot creek butte

Utah FORGE: Well 9-1 Logs and Data from Roosevelt Hot Springs Area

Mar 03, 2016
166.63 MB
Publicly accessible
This is a compilation of logs and data from Well 9-1 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to the...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermalgeothermal wellswell logsutah well logsmilfordtemperaturemulti-shotdirectionalgeochemicalammoniasilicaanalysisdaily report1975core logacoustic cement bondcompensated sonicboreholedensilogformation densitydownholegeophysicsgeophysicalsurveygamma rayneutronporosityinductionmudsubsurfacewell logwell datautah9-1resourcecharacterizationroosevelt hot springs

Utah FORGE: Well and Spring Chemistry

Jan 01, 2002
Size unavailable
Publicly accessible
This is a database containing water chemistry of wells and springs in Utah. The data is located at the Utah Geological Survey. This contains data relevant to the Utah FORGE project.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah water chemistrywater chemistryutahutah geothermalwater qualitygwgroundwaterground watersamplingwellspringchemistrywateraqueouswell dataspringsmilfordroosevelt hot springs

Utah FORGE: Great Basin Groundwater Geochemical Database

Jan 01, 2005
Size unavailable
Publicly accessible
A database of groundwater chemistry in the Great Basin, USA. The data is located at the Nevada Bureau of Mines and Geology. This contains data relevant to the Utah FORGE site.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalwater chemistryforgeutah forgegreat basingreat basin water chemistryegsgeochemistryground watergwsamplingqualitywatergroudwaterutahwell chemistrygroundwatermilfordroosevelt hot springs

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Utah FORGE: Microseismic Surface Network Catalogs for Wells 16A(78)-32 and 16B(78)-32 Stimulation 2022 and Circulation 2023

Feb 09, 2024
32.36 kB
Publicly accessible
This dataset includes microseismic surface network catalogs for Utah FORGE. Data were recorded during the stimulation of well 16A(78)-32 in 2022 and the circulation tests between wells 16A(78)-32 and 16B(78)-32 in 2023. Near-surface seismic monitoring during circulation experimen...
Authors
Niemz, P. et al University of Utah Seismograph Stations
geothermalenergyutah forgewell 16a78-32well 16b78-3216a16bmicroseismic datamicroseismiccirculation testcirculationstimulationfracingroosevelt hot springseismic dataseismicegsmicroseismic eventscataloggeophysics

Utah FORGE: Composite 3D Seismic Velocity Model

Feb 09, 2024
1.56 MB
Publicly accessible
This is a composite 3D seismic velocity that was constructed from compiled information from several local studies regarding seismic velocities and structural information. This seismic velocity model is provided in NonLinLoc format (slow_len), which is readily usable in NonLinLoc ...
Authors
Finger, C. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic modelseismic velocity modelseismic velocityseismicityroosevelt hot springmilfordutah geothermalegs3d seismic velocity modelpythonnonlinloccomposite modelcodeseismicgeophysicssubsurface model

Rare Earth Element Content of Thermal Fluids from Surprise Valley, California

Sep 23, 2015
830.5 kB
Publicly accessible
Rare earth element measurements for thermal fluids from Surprise Valley, California. Samples were collected in acid washed HDPE bottles and acidified with concentrated trace element clean (Fisher Scientific) nitric acid. Samples were pre-concentrated by a factor of approximately 1...
Authors
Fowler, A. and Zierenberg, R. University of California
geothermalrare earth elementssurprise valleymineral recoveryrare earth element aqueous chemistryhot springsboiling springsreeaqueous chemistrycontent modelaqueous chemistry analysisaasg

Utah FORGE: Observation Well Data

Feb 22, 2018
3.92 MB
Publicly accessible
This archive contains temperature data for Roosevelt Hot Springs observation wells OH-1, OH-4, OH-5 and OH-7. There are also mud logs for OH-4. These are old datasets obtained from Rocky Mountain Power for use in the Utah FORGE project. Temperature data were collected in the 1970s...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergytemperature logsforgeutah forgeroosevelt hot springsblundel power plantmud logsroosevelt hot springs observation wellstemperature surveygeologic loglithology logwell logutahwelllogdataobservationtemperatureoh-4oh-1oh-5oh-7mud logwell dataresourcecharacterizationmilfordegs

Utah FORGE: Geology Map and GIS Data

Mar 15, 2018
528.07 MB
Publicly accessible
This archive contains a geology map of the general Roosevelt Hot Springs region, both in PDF and ArcGIS geodatabase formats, that was created as part of the Utah FORGE project.
Authors
Kirby, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergygeologygeology mapgisgeospatialgeospatial datafaultslithologygeologic featuresforgeutah forgegeodatabaseroosevelt hot springsutshapefileutahmapegsmilfordgeologic maparcgis

Western USA Assessment of High Value Materials in Geothermal Fluids and Produced Fluids

Oct 31, 2018
13.53 MB
Publicly accessible
This submission includes the following: Field Characteristics: Describes the geological and production field characteristics of sampling sites Geochemistry of Produced Fluids Idaho-Nevada-New Mexico-Oregon-Utah: Summarizes the all the analytical results for aqueous samples...
Authors
Simmons, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergygeologyproduction fieldsfluid geochemistrytrace elementsstable isotopeshelium isotopestrace element geochemistryrocksdrill cuttingscalcite scalesroosevelt hot springsdixie valleybeowawemineralogy-lithologymineral depositsdrillcuttingsmineralogynevadautahidahooregonnew mexicoproducedwaterfluidgeochemistryreservoirtrace elementmineraldepositgeologicalgeochemicalcoproducedcritical elements

Utah FORGE: Seismic and Other Shapefiles from the Roosevelt Hot Springs Area

Mar 22, 2016
18.51 kB
Publicly accessible
Three shapefiles in this submission show the position of proposed seismic line surveys. The mid-crustal velocity anomaly file shows the extent of an anomalously low P-wave velocity zone in the subsurface. Two other files show the extent of known hydrothermal systems in the Rooseve...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalseismiclinesroosevelthydrothermalmilfordutahegsforgewater pipelinesystem2d3darcgisgisshapefileshape filegeospatial datautah forgegeophysicsroosevelt hot springsvelocitydeep drillingvelocity anomalycrustalmid-crustalp-wave

Hot Pot: Field Observations

Jun 28, 2013
61.59 kB
Publicly accessible
Map of field observations including depressions, springs, evidence of former springs, travertine terraces and vegetation patterns. Map also contains interpretation of possible spring alignments.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeologyfield observationsmetadatagismap packagegeospatial data

Helium isotope study of Geothermal Features in Chile with Field and Laboratory Data

Feb 11, 2013
12.51 kB
Publicly accessible
Helium isotope and stable isotope data from the El Tatio, Tinginguirica, Chillan, and Tolhuaca geothermal systems, Chile. Data from this submission are discussed in: Dobson, P.F., Kennedy, B.M., Reich, M., Sanchez, P., and Morata, D. (2013) Effects of volcanism, crustal thickness,...
Authors
Dobson, P. et al Lawrence Berkeley National Laboratory
geothermalhelium isotopesstable isotopeschillanel tatiotolhuacatinginguiricachilehe isotopesfield measurementshot spring samplesfumarole samplesgeochemistry

Utah FORGE: Regional Well Locations

Feb 22, 2018
7.42 kB
Publicly accessible
This archive contains a GIS point feature shapefile that shows the locations of wells in the general region of the Utah FORGE project, near Roosevelt Hot Springs. This includes Utah FORGE deep well 58-32 and wells for which data has been uploaded to the Geothermal Data Repository....
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgewellsspatial datagis datashapefilewell locationsroosevelt hot springswell indexarcgisgeospatial datawelllocation58-32utahegsmilfordregionalwell location

Utah FORGE: Area Terrain Slope Data

Dec 10, 2018
9.27 GB
Publicly accessible
This archive contains a terrain slope image, in units of degrees, of the Utah FORGE area near Roosevelt Hot springs. The data was derived from 0.5 m resolution LiDAR DEM data and is in a GeoTiff format. It was processed using ArcGIS.
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeslopeslope imageroosevelt hot springsterrain slopeslope degreesutah forgemilfordtopographylidardigital elevation modeldemgeotiffgeospatial dataarcgisgisutahterrainprocessed dataegsremote sensing

Maps, Models and Data from Southeastern Great Basin PFA

Jun 30, 2017
846.11 kB
Publicly accessible
This submission includes composite risk segment models in raster format for permeability, heat of the earth, and MT, as well as the final PFA model of geothermal exploration risk in Southwestern Utah, USA. Additionally, this submission has data regarding hydrothermally altered are...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyexplorationplay fairway analysisutahheatpermeabilityopalmtmagnetotelluricpfahydrothermal alterationsinterhidden geothermal systemsblind geothermal systemsshapefileshape filearcgisgisgeospatial dataxrdx-ray diffractionmilfordphase 2segbgbgreat basinse great basineasterngeophysicsheat floweastern great basinhydrothermal

Utah FORGE: Soil Helium R/RA Data

Mar 12, 2018
8.91 kB
Publicly accessible
This is a Helium isotope R/RA values from the Utah FORGE area near Roosevelt Hot Springs.
Authors
Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyheliumr/rahe r/rautah forgeforgesoil gasheroosevelt hot springssoil gas surveysoilisotopeutahgeochemistrysoil heliummilfordegs

Utah FORGE: Area LiDAR Bare Earth DEM Mosaic

Aug 07, 2018
6.86 GB
Publicly accessible
This is a mosaic of 154 bare earth DEM panels (0.5 m resolution) acquired during Phase II of the Utah FORGE project. The DEM covers the western Mineral Mountains and adjoining basin including the Roosevelt Hot Springs area. The coordinates are in UTM Zone 12, NAD 83 and elevation ...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergylidarlidar demlidar bare earthroosevelt hot springsutah forgeforgedigital elevation modelfrontier observatory for research in geothermal energyutahutgeospatial databare earthmodelgeotiffremote sensingdemphase 2elevationegsmilfordprocessed datamineral mountains

Brady's Geothermal Field Reftek Seismometer Metadata

Mar 26, 2016
457.21 kB
Publicly accessible
Metadata for the Reftek seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatareftekseismometerseismicarraypassive seismicporotomobradygeophysicsmonitoringseismicity

Utah FORGE: Soil Carbon Dioxide Data

Mar 12, 2018
160.02 kB
Publicly accessible
These are data from soil CO2 flux surveys done in the Utah FORGE study area near Roosevelt Hot Springs. Concentration is in units of ppm and is the final concentration of CO2 in the chamber after the up-to-2-minute flux measurement. Flux is in units of grams of CO2 per m^2.
Authors
Rahilly, K. Energy and Geoscience Institute at the University of Utah
geothermalenergycarbon dioxideco2co2 fluxutah forgeutahforgeroosevelt hot springssoil gasco2 concentrationconcentrationsoilmilfordegsgeochemistryflux
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service