OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 103.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"geochemistry data"×
Drilling and Completion×

Utah FORGE: Well 14-2 Logs and Data from Roosevelt Hot Spring Area

Mar 03, 2016
96.02 MB
Publicly accessible
This is a compilation of logs and data from Well 14-2 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Data includes: flowmeter survey (1989), geochemistry (1977-1978, 1977-1983), injection test data (1979, 1982), and spinner surveys (19...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermal wellsutah well logswell logsgeothermal wellsgeothermal well logsutah egsgeophysicsdownholeboreholemud logspinner surveyinjection testgeochemistryflowmeter testsonicgammaporositytemperaturepressuresurveysubsurfaceinductioncalipercompensated neutronformation densityutahwell datawell log14-2resourcecharacterizationmilfordroosevelt hot springsflowmeterspinnergamma raycompensatedneutronformationdensityelectricsteam injection

Utah FORGE: Well 82-33 Logs and Data, Roosevelt Hot Spring Area

Mar 03, 2016
74.2 MB
Publicly accessible
This is a compilation of logs and data from Well 82-33 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgeutah egsroosevelt hot springgeothermal well logswell logsutah well logsgeothermal wellsutah geothermal wellsroosevel hot springbottom hole pressurecasing schematiccleanoutsdirctional surveygeochemistrygeology loginjection cpaacitymorning reportsplan of operationsspinner surveyinjection testwater analysiswater chemistrycompensated soniccalipercement bondcollar logcompensated neutronformation densitydifferential temperaturegamma raymud loginductionpressure surveytemperature surveywell logwell data82-33utahresourcecharacterizationmilfordroosevelt hot springs

Western USA Assessment of High Value Materials in Geothermal Fluids and Produced Fluids Final Report

Mar 18, 2019
12.34 MB
Publicly accessible
This report documents the results of investigations dealing with the concentrations and availabilities of strategic, critical and valuable materials (SCVM) in produced waters from geothermal and hydrocarbon reservoirs (50-250 degrees C) in Idaho, Nevada, New Mexico, Oregon, and Ut...
Authors
Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergystrategic critical metalsproduced geothermal fluidsproduced hydrocarbon fluidswestern usanevadautahidahooregonnew mexicogeologyproduction fieldsfluidgeochemistrytrace elementsstable isotopeshelium isotopesrocksdrill cuttingscalcite scalesroosevelt hot springsdixie valleybeowawemineralogy-lithologymineralogylithologycritical elementsmineral depositsdrillingproducedwaterreservoirtrace elementmineraldepositgeologicalgeochemicalcoproducedscvmstrategiccritical and valuable materials

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Exploration Best Practices on OpenEI

Sep 20, 2013
63.84 kB
Publicly accessible
This is an electronic database detailing different types of, various phases of, best practices for, and cost and time associated with geothermal exploration techniques. The groups of exploration techniques included in the database are Data and Modeling Techniques, Downhole Techniq...
Authors
Young, K. National Renewable Energy Laboratory
geothermalexplorationgeophysicsopeneiremote sensingconceptual modelsexploration costsbest practicesloggingdrillinggeochemistryresistivity surveymt surveyelectromagnetic surveygravityseismicisotopelidarhyperspectralmultispectralswirflirinsarsarreflectionrefractonmagneticsdc resistivity2-m probewell loggingdatabase link

Geothermal Exploration Cost and Time

Feb 13, 2013
14.89 kB
Publicly accessible
This paper describes the methodology used to define the baseline exploration suite of techniques (baseline), as well as the approach that was used to create the cost and time data set that populates the baseline. The resulting product, an online tool for measuring impact, and the ...
Authors
Jenne, S. National Renewable Energy Laboratory
geothermalcosttimeexplorationgeophysicsgeochemistrydrillingremote sensingeconomic

Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
97.37 MB
Publicly accessible
This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egsroosevelt hot springutah geothermal wellswell logsutah well logsutah geothermalgeothermal well logsroosevelt hot springswater analysiswater qualitygeochemistryflow samplewireline samplepressure surveytemperature surveysubsurfacehistorywell schematicsite mapwell locationscasing schematicwell completionbhtgradienthydrothermal alterationcompensated soniccompensated neutronformation densityporositylaterlogdual inductionelectromagneticelectro-magneticthickness toolfracture identificationmud logcaliperboreholedownholegeophysicssurveygeophysicalgeochemicalwell datautah52-21well logresourcecharacterizationmilford

Utah FORGE: Evaluation of Potential Geochemical Responses to Injection in the FORGE Geothermal Reservoir

Apr 03, 2019
324.78 kB
Publicly accessible
Plugging of fracture porosity from mineral precipitation due to injecting cold water into a a geothermal reservoir can impact the overall permeability of the fracture network in the reservoir. This can have serious ramifications on the efficiency of the geothermal resource. Geoche...
Authors
Patil, V. and Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyforge-utahgeochemistrynumerical modelingfractureinjection testporosityfracture networkmodelingwell 58-32well datastimulationdrillingroosevelt hot springswell 45-3reservoirmineralsthermalaqueousquartzcalciteillitekaolinitephpolythermalreaction pathutah forgeegsmilfordutahenergy geoscience institute

Hawthorne Nevada Deep Direct-Use Feasibility Study References, Reports, Literature

Mar 29, 2018
189.25 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorneel capitandrillingwell datadrilling data

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

Supercritical Drilling Materials Analysis: Report on Resources, Challenges, and Needed Technologies

May 01, 2026
19.98 MB
Awaiting release
This report describes a comprehensive review of 49 existing supercritical geothermal wells to inform future geothermal drilling attempts and avoid previous failure points and understand material and testing limitations, while collating information gathered in a publicly accessible...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercriticaldrilling materialswell completionwellborematerial validationmaterial testinglaboratory experimentswell casingcasing connectionscementdrill bitfluid chemistrylost circulation materialslinerdrill stringsmaterial performancefailure pointsliterature reviewsupercritical wellsgeothermal wellsgeochemistrycirculationdrilling fluidstechnical reportnesjavellirhengillreykjaneskraflalarderellocampi flegreinisyroskakkondapunathe geyserssalton sealos humerosmenengai

Testing LCM on a Large Scale for Geothermal Drilling Applications Using a Novel Experimental Setup

Apr 22, 2022
15.98 MB
Publicly accessible
Rheology data obtained from flow loop tests, performed using different lost circulation materials (LCM) to study their effect on fluid rheology and wellbore hydraulics. The sealing performance of different LCM was tested using different fracture sizes. Five academic papers / repor...
Authors
Mohamed, A. et al University of Oklahoma
geothermal drillinglost circulationsealing efficiencyrheologyhigh temperatureflow loop3d printingtemperaturecharacterizationdrilling fluid additivesshape memory polymergeothermal wellshpht challengesdrilling fluidwellbore hydraulicshole cleaningfluid stabilitysmart lcmht flow looplost circulation materialannular flowrheological propertiesgeothermalenergyviscosifierfiltration controlhphtgeochemistrywellboredrilling technologyexperimenttechnologyreportsgwmodeldrillingprocessed data

Deep Sedimentary Basin EGS Development Reports

Jan 24, 2013
665.96 MB
Publicly accessible
This submission includes a Stage Gate Report on "Novel Geothermal Development of Deep Sedimentary Systems in the United States," along with supporting reports, presentations, and theses related to deep sedimentary basin geothermal development.. Stratigraphic reservoirs with high ...
Authors
Allis, R. and Moore, J. University of Utah
geothermalsedimentary aquifersbasin stratigraphytemperature distributionsheat flowreservoir modelingstratigraphic reservoirspermeabilityhydrofracturingdrillingpower productionsolarcarbonatessiliciclasticsreportdeep sedimentarystage gatetechnical report

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

Utah FORGE: Well 16A(78)-32 Drilling Data

Jan 08, 2021
2.57 GB
Publicly accessible
This dataset includes survey data, drilling data, daily reports, summaries of daily operations, and rig photos from the drilling of Utah FORGE well 16A(78)-32, which is a highly deviated deep well. It was completed 60 days ahead of schedule. Rig move in began 10/22/2020 and dril...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedrillingdirectional16a78-32time seriessurveytrajectoryraw dataegsrigphotosoperationsdeviateddeep wellhighly deviatedforgeutahpasonpason data

Utah FORGE: Drilling Data for Student Competition

Dec 07, 2018
604.64 MB
Publicly accessible
Diagnostic drilling data (Pason log files) from Well 58-32 (previously labeled MU-ESW1), which was drilled near Milford Utah during Phase 2B of the FORGE Project to confirm geothermal reservoir characteristics met requirements for the final FORGE site. This dataset includes both ...
Authors
Podgorney, R. et al Idaho National Laboratory
geothermalenergyforgeutahstudent competitiondrillingpason58-32egsroosevelt hot springsmilfordlogssubsurfaceperformancerigbitsmaterialsdownscaledmu-esw1roppump pressurewobweight on bitrate of penetrationtemperaturedepthtdtorqueflowwelllogdatadrillphase 2bresourcecharacterizationdrilling datawell datautah forgeraw dataprocessed data

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Utah FORGE: Well 78B-32 Daily Drilling Reports and Logs

Aug 09, 2021
11.89 GB
Publicly accessible
This data set includes the daily drilling reports and Pason data for well 78B-32 and Schlumberger logs acquired after drilling completion. This well was drilled between June 27th and July 31st of 2021. Also included is raw and processed data for a variety of well data metrics incl...
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 78b-32well 78b-32 fmi logswell 78b-32 ubi logswell 78b-32 drilling datautah forge well 78b-32daily reportsdaily drilling reportsprocess dataraw datagamma rayporositylogscementtemperaturedensityresistivityfractureubifmisonicwell databoreholewelldatagammadrillingreportscblcement bond logpason data

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service