OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 42.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"geologic units"×
Seismic×

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Newberry Caldera Conceptual Geologic Model

Mar 04, 2016
Size unavailable
Publicly accessible
Conceptual model for the Newberry Caldera geothermal area. Model is centered around caldera and evaluates geologic information in tandem with some geophysical datasets to derive a conceptual subsurface model. Includes: Geologic information from the USGS geologic map of Newberry...
Authors
Moser, M. et al National Energy Technology Laboratory
geothermalgeologic modelegsenhanced geothermal systemnewgennewberryoregonfaultsstructureseismicconceptual modelsubsurface modelgeologygeologicalmodelconceptual

West Flank Coso FORGE: ArcGIS Data for Geologic Model

Mar 01, 2016
154.12 kB
Publicly accessible
Archive of ArcGIS data from the West Flank FORGE site located in Coso, California. Archive contains the following eight shapefiles: Polygon of the 3D geologic model (WestFlank3DGeologicModelExtent) Polylines of the traces 3D modeled faults (WestFlank3DModeledFaultTraces) Polyline...
Authors
Sandia National Laboratories
geothermalforgewest flankegscosoarcgis datacross-sectionseismic reflectionwell pathwell collarfault tracewell pathswell collarsgeospatial datamodelgeologygeologicfaulttracecalifornia

Hawaii Play Fairway Analysis: USGS Quaternary Fault and Fold Database

Jan 01, 2015
Size unavailable
Publicly accessible
This database contains information on faults and associated folds in the United States that are believed to be sources of M>6 earthquakes during the Quaternary (the past 1,600,000 years). Maps of these geologic structures are linked to detailed descriptions and references. Used t...
Authors
Lautze, N. University of Hawaii
geothermalfaultshawaiiusgsfaultdatabasefoldstructuralfeaturesgeologygeologicseismicityactivequaternarygeologic unitpfa

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Utah FORGE: Leapfrog 3D Geologic Movie

May 18, 2018
Size unavailable
Publicly accessible
This is a 3D geological movie of the Utah FORGE area created with Leapfrog Geothermal 3D modelling software. The movie shows the Utah FORGE site, wells, seismic and lithologic cross-sections, and rock unit tops. This illustrates the thick crystalline granitoid EGS reservoir.
Authors
Podgorney, R. Energy and Geoscience Institute at the University of Utah
geothermalenergy3d geologyutah forgeutahroosevelt hot springsgeologic movieleapfrog movieforgeegsmodelgeologicleapfrogwellsseismiccross sectionformation topsgeologystructuralmodeling3dmoviemilfordreservoirgranitoidcrystalline

Nevada Great Basin Play Fairway Analysis Reports & Appendices

Oct 28, 2015
52.81 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. et al Nevada Bureau of Mines and Geology
geothermalnevadaplay fairwayreportappendicesgreat basinnbmgnvpfacarson sinksteptoe valleygeophysicsgeophysicalgeologygeologiclidargeochemicalgravityseismic reflectionmtmagnetotelluricsgeodeticgeodesyshallow temperaturesoil gasslip and dilation tendancy3d modelingthermal modelingexplorationresource assessmentresource potentialinvestigationsurveypreliminarysite assessmentfavorabilitynv great basin

Fallon FORGE: Seismic Reflection Profiles

Feb 01, 2018
33.35 MB
Publicly accessible
Newly reprocessed Naval Air Station Fallon (1994) seismic lines: pre-stack depth migrations, with interpretations to support the Fallon FORGE (Phase 2B) 3D Geologic model. Data along seven profiles (>100 km of total profile length) through and adjacent to the Fallon site were re-...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallonnevadaseismicreflectionvetted-nodepth migrationgeophysicsprocessed dataprestackinterpretedsite mapsurvey mapreprocessed datareprocesseddata

Utah FORGE: DAS Microseismic Event Records From April 2024 Stimulation Experiment

Mar 25, 2026
1.29 TB
In curation
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (raw waveforms) recorded during the 16A-16B stimulations conducted at the Utah FORGE site in April 2024. The dataset consists of raw waveform data provided in nanostrain rate units, accompanied by...
Authors
Ajo-Franklin, J. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdistributed acoustic sensingdasfiber optic monitoringdfosmicroseismicforgewaveformraw datastimulationevent triggersfiber opticgeophysicsgeomechanicshydraulic stimulationhydraulic fracturingdas channel locationssgyseg-ysilixacarinafogmore

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Curated
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Utah FORGE: Mineral Mountains West Fault System Report

Jul 01, 2019
25.06 MB
Publicly accessible
This archive contains a report on the Mineral Mountains West fault system as part of phase 2C and the evidence for the northern terminus of this structure. Geologic field mapping, reprocessing of 3D seismic reflection data, and soil gas surveys contributed to this effort.
Authors
Simmons, S. and Miller, J. Energy and Geoscience Institute at the University of Utah
geothermalenergymineral mountainsutah forge phase 2cutah forgegeologic structurefaultsutah forge faultsmineral mountains west fault systemnorth milford valleyutahstructural geologysoil gas geochemistryphase 2c3d seismicgeochemicalgeophysicalgeologicalseismic reflectionfaultwell 58-32hydrothermal fluid flowhydrothermalco2 fluxhelium isotopessoil gasfault mappingsurface mappinggeomorphic analysisstratigraphyforgeegsroosevelt hot springsmilfordgeologygeophysicsgeochemistryseismic

Newberry EGS Demonstration: Initial Project Report and Induced Seismicity Mitigation Plan, 2011

May 05, 2024
70.06 MB
Publicly accessible
This is the first project report and induced seismicity mitigation plan for the Newberry Enhanced Geothermal Systems (EGS) Demonstration project. The primary objectives of this first phase were to obtain necessary permits and comply with all regulations, including NEPA, communica...
Authors
Cladouhos, T. et al AltaRock Energy Inc
geothermalenergynewberryegsdemonstrationvolcanoaltarockoregongeologygeologic modelconceptual resource modelseismicityinduced seismicitymitigationmaximum magnitudein situ stresspermittingstimulationreservoir characterizationdrilling planwell testingrisk mitigationreporting

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Utah FORGE 3-2417: DAS Microseismic Event Records From Circulation Test July 2023

Jul 09, 2025
17.07 GB
Curated
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (waveforms) recorded during the 16A-16B circulation tests conducted at the Utah FORGE site in July 2023 as part of the FOGMORE R&D project (Utah FORGE Project 3-2417). Data were acquired using Sil...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdasdistributed acoustic sensingmicroseismiccirculation testfiber optic monitoringsilixa carinasilixa idas v2nanostrain rateseismic dataseg-yjuly 2023raw datatriggeredchannel map

Utah FORGE: Downhole Geophone Seismic Data (August 2022)

Aug 25, 2022
Size unavailable
Publicly accessible
This is a link to downhole geophone data collected by Schlumberger. These data were collected in the Utah FORGE deep seismic monitoring wells 58-32 and 56-32. The format is a standard SEGY and the units are bits. To convert to acceleration (m/s2) multiply by 2.333 x 10-7. Use one ...
Authors
Pankow, K. and Schlumberger, S. University of Utah Seismograph Stations
geothermalenergyutah forgeseismic dataseismicitygeophone datadeep well geophones58-3256-32schlumberger datageophonedowndownhole geophoneschlumberger geophonegeophysicsseismicmonitoringdownholeforgeegsdeep

Newberry Caldera Conceptual Geophysical Model

Mar 04, 2016
Size unavailable
Publicly accessible
Conceptual model for the Newberry Caldera geothermal area. Model is centered around caldera and evaluates multiple geophysical datasets to derive a conceptual subsurface model. Includes: Conductor layer based on transient electromagnetic data from Fitterman et al., 1988 (figure...
Authors
Moser, M. et al National Energy Technology Laboratory
geothermalenhanced geothermal systemegsnewgennewberryoregongravityseismicconceptual modelsubsurface modelgeologic modelstructuregeophysicsfaultsmtmagnetotelluricmodelconceptualgeophysicalcaldera

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Curated
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Snake River Plain Play Fairway Analysis: Phase 2 Report and Phase 3 Proposal

Sep 05, 2017
33.13 MB
Publicly accessible
This report presents the results of Phase 2 of the Snake River Plain Play Fairway Analysis project, and a summary of proposed work for Phase 3. Phase 2 focused on new data collection in specific areas of interest identified in Phase 1. These data include new magnetotelluric, seism...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainmountain homecamas prairiebostic-1thermal wellmagnetotelluricseismicgravitymagneticstructuralblindresourcecharacterizationidahogeologyar-arbasalticvolcanovolcanic rockwell datathermalgeophysicssrpmtpfamodelingbostichydrologicwaterchemistrysurvey

Newberry EGS Literature References

Apr 22, 2016
69.94 kB
Publicly accessible
Research references to literature about the Newberry geothermal area, Oregon.
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengeophysicsgeologyhydrothermalseismicstructurep waveelectricmagnetotelluriclithologyliteraturefield guidegeologic historyvolcano hazardsframeworkpetrologyexploratory drillingslimholeexplorationflow testingdrillholestructuralactive sourceteleseismictomographyresource characterizationmagma chambercrustalvelocitygravityemelectricalcompressional wavecoremineralogy

Newberry EGS Well Logs, Earthquakes, Maps, Cross-Sections, and LiDAR Datasets

Apr 22, 2016
13.4 kB
Publicly accessible
Datasets and information used to characterize the subsurface of Newberry and support modeling efforts. Includes sources for well logs, earthquakes, maps & cross-sections, and LiDAR/DEM
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewgennewberryoregonearthquakesseismicgeologic maplidardemdatasetmodelwell logearthquakeseismicitymapcross-sectionremote sensing

2D Seismic Profiles, Nevada Play Fairway Granite Springs Valley

Sep 14, 2017
154.59 MB
Publicly accessible
This data is associated with the Nevada Play Fairway project and contains 2D seismic profile data in cropped jpegs and tiffs, both interpreted and uninterpreted. Seismic data owned or controlled by Seismic Exchange, Inc.; interpretation is that of the University of Nevada, Reno.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergyseismic profilegranite springs valleypfaplay fairwaygeophysicsseismicinterpretationprofilegeophysicaldataimagingnevadanvactive sourcenv great basin

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service