OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 67.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"magnetic separation"×

Magnetic Nanofluid Rare Earth Element Extraction Process Report, Techno Economic Analysis, and Results for Geothermal Fluids

Mar 14, 2016
1.86 MB
Publicly accessible
This GDR submission is an interim technical report and raw data files from the first year of testing on functionalized nanoparticles for rare earth element extraction from geothermal fluids. The report contains Rare Earth Element uptake results (percent removal, mg Rare Earth Ele...
Authors
McGrail, P. Pacific Northwest National Laboratory
geothermalreemofnanofluidrare earth elementmetal organic frameworkgeothermal mineral recoveryneodymiumeuropiumyttriumdysprosiumcesiummagnetic separationmetal uptaketechno economic analysisrare earth element extractiontechno economicsilica sorbentsuptake results

Chelating Resins for Selective Separation and Recovery of Rare Earth Elements from Low Temperature Geothermal Water

Dec 31, 2016
100.34 kB
Publicly accessible
Study on the use of organic ligands to extract lanthanides from low temperature geothermal water.
Authors
Callura, J. Carnegie Mellon University
geothermalrare earth elementlanthanideadsorptionmineral revcoveryselective separationlow templow temperaturechelating resinscarnegie mellongeochemistrymineralogybrinechemical propertiesphysical propertiescomposition

Gd Uptake Experiments for Preliminary Set of Functionalized Adsorbents (With Content Model)

Jul 01, 2015
261.5 kB
Publicly accessible
These data summarize adsorption experiments conducted with Gd in 0.5 M NaCl. Results represent preliminary, proof-of-concept data utilizing fine-powder silica gel as the adsorbent support. Future testing will focus on larger, application-appropriate beads.
Authors
Noack, C. Carnegie Mellon University
geothermalreeadsorptionseparationgd uptakegadoliniumgdmineral uptakeusgin content modelngds content modelgeochemistrywater chemistrybrinechemistrybrine studyadsorbentsilica gelcontent model

Dynamic Earth Energy Storage: Terawatt-Year, Grid-Scale Energy Storage using Planet Earth as a Thermal Battery (GeoTES): Seedling Project Final Report

May 31, 2019
4.48 MB
Publicly accessible
Grid-scale energy storage has been identified as a needed technology to support the continued build-out of intermittent renewable energy resources. As of April 2017, the U.S. had approximately 24.2 GW of energy storage on line, compared to 1,081 GW of installed generation capacity...
Authors
McLing, T. et al Idaho National Laboratory
energy storagegeothermal energythermal energy storagegeotestestemperatureporositymodelingsteamrankine cycleflue gasheatrecoverythermalhydrologylinear stabilitydirect usegoethermalbrinegrid stabilizationinjection testweber formationweber sandstonertes

Acquisition and Processing of a Detailed Aeromagnetic Survey Glass Buttes, Oregon

May 27, 2010
11.33 MB
Publicly accessible
Using an ultra-light aircraft, a high-resolution aeromagnetic survey was carried out over Ormat Nevada's Glass Buttes project area in Oregon. Survey operations were completed on May 25, 2010. Average terrain clearance was 223 meters from the sensor. A total of 1,352 line-miles o...
Authors
Akerley, J. Ormat Nevada Inc
geothermaloregonaeromagneticmagnetic surveyaeromagneticsgeophysicshorizontal gradientrtptilt derivativemagnetic anomalytmiorsurvey maplocation mapsurvey linesmagnetic anomaly maptotal magnetic intensityreduction to polemagneticsglass buttesreduced to polereportmap

Magnetic Test Loop Particle Retention Data for REE Extraction from Geothermal Fluids

Jul 27, 2018
396.3 kB
Publicly accessible
Measurements of particle extraction efficiency under various flow rate and magnetic power conditions
Authors
McGrail, P. and Liu, J. Pacific Northwest National Laboratory
geothermalenergymineral extractionreerare earthretentionoperationratecomparisonnanoparticleabsorbancemagneticextractionelementmineralparticle

Ground Magnetic Data for West-Central Colorado

Mar 08, 2012
303.47 MB
Publicly accessible
Modeled ground magnetic data was extracted from the Pan American Center for Earth and Environmental Studies database at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was then imported into an Excel sprea...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalcoloradomagneticsshapefilewestcentralwest-centralshape filegisarcgisgeospatialmagneticfield strengthpoint shapefilegrounddatageospatial data

Maui Aeromagnetic Survey

Apr 17, 2010
90.3 MB
Publicly accessible
Map, image, and data files, and a summary report of a high-resolution aeromagnetic survey of southern Maui, Hawai'i completed by EDCON-PRJ, Inc. for Ormat Nevada Inc using an helicopter and a towed sensor array.
Authors
Akerley, J. Ormat Nevada Inc
geothermalhawaiimauiaeromagaeromagneticssurveymagnetometergeometricshaleakalavolcanototal magnetic intensityreduced to polehorizontal gradienttiltderivative

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

Core-Shell REE Sorbent Extraction Data

Apr 27, 2017
19.17 kB
Publicly accessible
Solution chemical analysis data for magnetic core shell sorbent materials. Deionized water and brine solutions were spiked with five rare earth elements and the solutions analyzed after approximately 5 minutes exposure to the sorbent particles.
Authors
Thallapally, P. Pacific Northwest National Laboratory
geothermalenergyreemineral recoveryrare earth elementschemistrychemical analysismagneticcore shellsorbent materialsbrine studybrine

West Flank Coso, CA Magnetic and Gravity Data

May 19, 2016
4.23 MB
Publicly accessible
Gravity and aeromagnetic data for West Flank FORGE site.
Authors
Katzenstein, A. et al Sandia National Laboratories
geothermalegsforgewest flankgravitymagneticaeromagneticgeophysicsgeophysical dataindian wells valleyeast-central californiacametamorphicstructuralaeromagcore complexcesium vapormagnetometercoso rangecoso

GeoDAWN: Airborne magnetic and radiometric surveys of the northwestern Great Basin, Nevada and California

Mar 01, 2024
Size unavailable
Publicly accessible
This submission encompasses the airborne magnetic and radiometric survey data from the northwestern Great Basin in Nevada and California, collected under the GeoDAWN initiative: Geoscience Data Acquisition for Western Nevada. Included in the dataset are all flight details, geophys...
Authors
Glen, J. and Earney, T. United States Geological Survey
geothermalenergygeodawnnevadacaliforniaremote sensingearthmriexplorationprocessed datamappingaerialmagneticradiometricgreat basinmineralusgsgeospatialgeologygeophysicsairbornesurface geologysoil compositionsubsurface structurehigh-resolution

Play Fairway Analysis CA-NV-OR: San Emidio Geophysical Data

Aug 05, 2015
12.56 MB
Publicly accessible
Various geophysical exploration data for San Emidio KGRA
Authors
M, C. University of California
geothermalgeophysicssan emidiogravityself potential resistivitygradiometrymagneticpsinsargeophysical surveyinvestigationassessmentsurveysiteresourcespinterferometrygradientremote sensingmagneticsinsarca-nv-orpfaplay fairway analysis

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Thermal Drawdown Induced Flow Channeling in Fractured Geothermal Reservoirs: Rock Mechanics and Rock Engineering

Nov 15, 2015
16.88 MB
Publicly accessible
We investigate the flow-channeling phenomenon caused by thermal drawdown in fractured geothermal reservoirs. A discrete fracture network-based, fully coupled thermal "hydrological" mechanical simulator is used to study the interactions between fluid flow, temperature change, and t...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalthermal drawdownflow channelingthermomechanical couplingreservoir simulationstimulationegsenhanced geothermal reservoirsexplosive fracturing

Advanced Sorbent Structure Recovery of Rare Earths, Precious Metals and Other Critical Materials from Geothermal Waters and Its Associated Technoeconomics

Sep 21, 2016
438.56 kB
Publicly accessible
The work evaluates, develops and demonstrates flexible, scalable mineral extraction technology for geothermal brines based upon solid phase sorbent materials with a specific focus upon rare earth elements (REEs). The selected organic and inorganic sorbent materials (silica and MOF...
Authors
Addleman, R. et al Pacific Northwest National Laboratory
geothermalsorbentsnanorare earth elementsreesprecious metalsmineral recoverygreen mininginorganic sorbent removal efficiencyorganic sorbent removal efficiencycomposite thin filmree

Fallon FORGE: Well Log Database

Jul 03, 2018
331.25 MB
Publicly accessible
Master well database for all logs and other well data pertaining to the Fallon FORGE site. Tables are formatted in NGDS Teir 3 schema where appropriate; redundancies between tables are omitted, and should be queried off of the main WellHeader table. All relationships are set on th...
Authors
Blankenship, D. Sandia National Laboratories
geothermalenergyfallonnevadaforgeegslogswell datawell loggeophysicsgeologygeochemistryrock propertieslithologywelllogcorecuttingsfracturesboreholeaqueous chemistrychemistryrockdensitynaturalinducedmagnetic susceptibilitypressuretemperaturespinnerptswireline

Fluid Rare Earth Element Analyses from Wells RN-12 and RN-19, Reykjanes, Iceland

Jul 24, 2015
596.5 kB
Publicly accessible
Results for fluid rare earth element analyses from Reykjanes wells RN-12 and RN-19. The data have not been corrected for flashing. Samples pre-concentrated using chelating resin with IDA functional group (InertSep ME-1). Analyzed using an element magnetic sector ICP-MS.
Authors
Fowler, A. and Zierenberg, R. University of California
geothermalreebrinereykjanesicelandrare earth elementsrn-12rn-19chemistrygeochemistrywater chemistrybrine studyusgin content modelngds content modelcontent modelicp-mselement magnetic sectoraqueous chemistry

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Snake River Plain Play Fairway Analysis: Phase 2 Report and Phase 3 Proposal

Sep 05, 2017
33.13 MB
Publicly accessible
This report presents the results of Phase 2 of the Snake River Plain Play Fairway Analysis project, and a summary of proposed work for Phase 3. Phase 2 focused on new data collection in specific areas of interest identified in Phase 1. These data include new magnetotelluric, seism...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainmountain homecamas prairiebostic-1thermal wellmagnetotelluricseismicgravitymagneticstructuralblindresourcecharacterizationidahogeologyar-arbasalticvolcanovolcanic rockwell datathermalgeophysicssrpmtpfamodelingbostichydrologicwaterchemistrysurvey

Advanced Sorbent Structure Recovery of REEs, Precious Metals and Other Valuable Metals from Geothermal Waters and Its Associated Technoeconomics

May 25, 2017
483.89 kB
Publicly accessible
This work evaluates, develops and demonstrates flexible, scalable mineral extraction technology for geothermal brines based upon solid phase sorbent materials with a specific focus upon rare earth elements (REEs). The selected organic and inorganic sorbent materials demonstrated h...
Authors
Addleman, S. et al Pacific Northwest National Laboratory
geothermalsorbentsnanorare earth elementsreesprecious metalsmineral recoverygreen mininginorganic sorbent removal efficiencyorganic sorbent removal efficiencycomposite thin filmtechnoeconomicslanthanumeuropiumholmiumsilvercopperzinc

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Utah FORGE: LBNL Status Report on the VEMP Tool 2024

Feb 16, 2024
492.57 kB
Publicly accessible
This report describes the modifications made to the Vertical Electromagnetic Profiling (VEMP) borehole tool, currently on loan to Lawrence Berkeley National Laboratory (LBNL) from Japan's Geothermal Energy Research and Development Co., Ltd. (GERD), during its refurbishment. It inc...
Authors
Wilt, M. et al Lawrence Berkeley National Laboratory
geothermalenergyutah forgeegsvempvertical electromagnetic profilinglbnltechnologygeophysicselectromagneticevaluationreporttool statusmagnetic fieldfield testscalibrationborehole tool

Snake River Plain Geothermal Play Fairway Analysis Project MT Data

May 06, 2018
12.02 MB
Publicly accessible
MT is measured in the field by using induction coils to measure the time-varying magnetic source for frequencies between 1000-0.001~Hz, and electric dipoles to measure the Earth's electrical response. Because the magnetic source field is polarized, orthogonal directions of the f...
Authors
Peacock, J. et al United States Geological Survey
geothermalenergysnake river plainpfaplay fairway analysisidahocamasprairiemagnetotelluricsmtdataresistivityconductivityelectricalgeophysicsgeophysicalsrp

Project HOTSPOT: Mountain Home Well Borehole Geophysics Database

Nov 11, 2012
209.37 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainproject hotspotidahoyellowstone hotspotborehole geophysicsmountain homegeophysicsborehole logdowhnhole geophysicstemperaturepressuregamma raymagnetic susceptibilitygeochemistrythoriumuraniumpotassiumneutronresistivityimage logsrpboreholewell data
123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service