OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 210.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"point data"×
Temperature and Heat Flow×

Penrose Well Temperatures

Mar 15, 2013
6.69 kB
Publicly accessible
Penrose Well Temperatures Geothermal waters have been encountered in several wells near Penrose in Fremont County, Colorado. Most of the wells were drilled for oil and gas exploration and, in a few cases, production. This ESRI point shapefile utilizes data from 95 wells in and a...
Authors
Christopherson, K. Flint Geothermal, LLC
geothermalcoloradofremont countytemperature gradientsoil and gas wellstemperature gradientpoint shapefileshapefileshape filewell datatemperaturepenrose welldatageospatial data

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

GBCGE Subsurface Database Explorer and APIs

Mar 16, 2020
Size unavailable
Publicly accessible
This submission defines a DOI for the Great Basin Center for Geothermal Energy's (GBCGE) Subsurface Database Explorer web application and underlying data services, and acknowledges the INGENIOUS project as a major source of funding for data compilation and quality assurance. The ...
Authors
Mlawsky, E. and Ayling, B. NBMG; GBCGE; UNR
geothermalenergygreat basinnevadautahidahooregoncaliforniawellsspringspower plantsstructural settingstemperaturechemistryinjectionproductionwell logscore photographydigitizationrelational databasedatabasepostgresqlsqlarcmap onlinerest serviceapiweb applicationweb map

Shallow (2-meter) Temperature Surveys in Colorado

Feb 01, 2012
10.72 kB
Publicly accessible
Shallow temperature surveys are useful in early-stage geothermal exploration to delineate surface outflow zones, with the intent to identify the source of upwelling, usually a fault. Detailed descriptions of the 2-meter survey method and equipment design can be found in Coolbaugh ...
Authors
E., R. Flint Geothermal, LLC
geothermalshallow temperature surveyscoloradoshallow temperature surveyarcgisgisshapefileshape filegeospatialdatageospatial dataexplorationremote sensinganomaly detectionfault detectiontemperatureupflow faultfault

AASG Wells Data for the EGS Test Site Planning and Analysis Task

Oct 09, 2013
32.16 MB
Publicly accessible
Temperature measurement data obtained from boreholes for the Association of American State Geologists (AASG) geothermal data project. Typically bottomhole temperatures are recorded from log headers, and this information is provided through a borehole temperature observation servic...
Authors
Augustine, C. National Renewable Energy Laboratory
geothermalwelltemperatureegs test sitebottomholeshpboreholeborehole temperaturedataegsgeospatial data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater

USGS Geophysics, Heat Flow, and Slip and Dilation Tendency Data used in Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
Size unavailable
Publicly accessible
This package contains USGS data contributions to the DOE-funded Nevada Geothermal Machine Learning Project, with the objective of developing a machine learning approach to identifying new geothermal systems in the Great Basin. This package contains three major data products (geoph...
Authors
DeAngelo, J. et al Nevada Bureau of Mines and Geology
geothermalenergygeophisicsnevadaslipdilationheat flowgravitymagneticsfaultsgeotiffsmachine learningexplorationcharacterizationhydrothermalgreat basingeophysicspfa

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

Harsh Environment Sensors for Geothermal Applications

Jan 01, 2012
2.36 MB
Publicly accessible
Technical papers detailing the development of harsh environment sensors for geothermal applications. Principle Investigator is Prof. Albert P. Pisano (University of California, Berkeley). Submission includes a paper about geothermal environmental exposure testing on encapsulant a...
Authors
Senesky, D. et al Regents of the University University of California
geothermalharsh environmentsensorpressuretemperaturesilicon carbidesapphirealuminum nitridedown-holeloggingmonitoringmemsencapsulationexposureenvironmental exposuredownholemass changesputter xpschemical analysismicroelectromechanical

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

Sedimentary Geothermal Feasibility Colorado Well Database

Oct 31, 2019
159.42 MB
Publicly accessible
Well data were mined from Geothermal Prospector (GTP), Southern Methodist University (SMU), the Colorado Oil and Gas Conservation Commission (COGCC), and the Colorado Geological Survey (CGS). The well data gathered was then used to assess sedimentary geothermal feasibility in the ...
Authors
Taverna, N. National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitywell datatemperatureformationdepthsedimentary basingeospatial datahugoton embaymentnorth park basinparadox basinpiceance basinraton basindenver basinsand wash basinsedgeocgsgtpcogccshapefile

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

EGS Collab Experiment 1: Temperature profile

Apr 01, 2019
18.7 MB
Publicly accessible
This submission includes an input file, plot file, Fortran conversion file, and 3D data file from the simulation of the temperature profile within the Test Bed #1 of the EGS Collab project. The simulation was executed with PNNL's STOMP-GT simulator, which reads the input file, and...
Authors
White, M. Pacific Northwest National Laboratory
geothermalenergysurfegs collabnumerical simulationstomp-gtdataegstemperaturedistribution3dwest access driftfortrancodesanford underground research facility

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

High-Pressure and High-Temperature (HPHT) Lost Circulation Material (LCM) Testing

Nov 30, 2021
7.92 MB
Publicly accessible
High-pressure and high-temperature (HPHT) lost circulation material (LCM) rheology test results, LCM particle size distributions (PSD) analysis, and HPHT LCM fluid loss test results. Three academic papers / reports derived from this research are also presented.
Authors
Salehi, S. and Vivas, C. University of Oklahoma
geothermalenergylost circulation materialshpht filtrationfracture sealingparticle size distributionrheologydrilling fluid additivesgelationthermal degradationhigh pressure high temperaturepsdtemperaturemodeldrillingwellboreexperimenttechnologyprocessed datalcm

Lightning Dock Geothermal Field Data Package, Hidalgo County, New Mexico

Aug 19, 2026
7.4 GB
Publicly accessible
This submission is a curated geoscience, well and plant-operations data package for the Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico, a liquid-dominated system produced for binary (ORC) power generation. It covers well-by-well data...
Authors
Ifrene, G. et al Zanskar Geothermal
lightning dockwell logsgisproduction datageothermalenergytracer testpower generationgeochemistrygeophysicsgroundwaterbinary systemorcdownhole temperaturebouguermagnetotelluricinversion modelsaeromagneticsgravity surveylidarquaternary faultgeologymud logstemperature

Structural Inventory of Great Basin Geothermal Systems and Definition of Favorable Structural Settings

Dec 31, 2013
244.5 kB
Publicly accessible
Structural controls of 426 geothermal systems in the Great Basin region including western Nevada, central Nevada, northwestern Nevada, northeastern Nevada, east-central Nevada, eastern California, southern Oregon, and western Utah were analyzed with literature research, air photos...
Authors
Faulds, J. University of Nevada
geothermalquaternary faultsstructural controlsblind geothermal systemstemperaturegeothermometryfield visitswestern nevadacentral nevadanorthwestern nevadanortheastern nevadaeast-central nevadaeastern californiasouthern oregonwestern utahutahnevadaoregoncaliforniabaltazor hot springblue mountainbog hot springdyke hot springshoward hot springmacfarlane hot springmcgee mountainpinto hot springsbeowawecrescent valleyhot springs pointdann ranchhand-me-down hot springsgolcondapumpernickel valleytipton hot springsash springschimney hot springduckwaterhiko hot springiverson springmoon river hot springmoorman springrailroad valleywilliams hot springwalleys hot springantelope valleyfales hot springsbuckeye hot springstravertine hot springsteels marshrhodes marshcolumbus marshalum-silver peakfish lake valleygabbs valleywild roserawhide-wedell hot springsalkali hot springsbaileys/hicks/burrell hot springsalvord hot springbaileys hot springburrell hot springhicks hot springantelope hot springhart mountainborax lakecrump geysermickey hot springnewcastleveyo hot springdixie hot springthermorooseveltcove fortred hill hot springjoseph hot springhatton hot springabraham-baker hot springsgreat basinhot creek butte

Low-Temperature Geothermal Geospatial Datasets: An Example from Alaska

Feb 06, 2023
242.5 MB
Publicly accessible
This project is a component of a broader effort focused on geothermal heating and cooling (GHC) with the aim of illustrating the numerous benefits of incorporating GHC and geothermal heat exchange (GHX) into community energy planning and national decarbonization strategies. To bet...
Authors
Davalos Elizondo, E. et al National Renewable Energy Laboratory
geothermalenergylow temperaturegeothermal resourcesdatasetheat flowthermal conductivitybottom-hole temperaturegeoreportrsatheat pumpghpgeothermal heat exchangelow tempgeologygeophysicsoil and gaswellgeospatial dataghcghxgeothermal heating and coolingalaskaresearch size assessment tool

Sedimentary Geothermal Feasibility in Eastern Nevada and Millard County, Utah Well Databases

Nov 30, 2019
8.57 MB
Publicly accessible
In order to gather data to assess sedimentary geothermal feasibility in Nevada and Utah, state oil and gas and geothermal databases were serached for well files and well logs. Well data from the Nevada Bureau of Mines and Geology oil and gas and geothermal databases was mined for ...
Authors
Taverna, N. National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitywell datatemperaturepermeabilityformationdepthsedimentary basinpavant butteelko basinsteptoe basinrailroad valleybacon flatmarys riverdiamond valleyblackburnn. willow creeknorth willow creektomera ranchblack rock desertmillard countysedgeo

Appalachian Basin Play Fairway Analysis: Thermal Quality Analysis in Low-Temperature Geothermal Play Fairway Analysis (GPFA-AB)

Nov 15, 2015
2.04 GB
Publicly accessible
This collection of files are part of a larger dataset uploaded in support of Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB). Phase 1 of the GPFA-AB project identified potential Geothermal Play Fairways within the Appalachian basin of Pennsylva...
Authors
E., T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginialow-temperaturegeothermal play fairway analysisgpfa-abdeep direct usedistrict heatingthermal analysisresource assessmentheat flowthermal conductivitygeothermsshapefileregional gridrasterr scriptbasementtrenton black river projectsediment thicknessbht correctionrome troughgravitymagneticsworm based interpolation boundarieswormsrisk of seismicityoutlierthermal modelthermal fielddepth-to-temperaturetemperature-at-depthcross validationkrigingfavorable countiesarcgiscosunacorrelation of stratigraphic units of north americademdigital elevation modellow temperaturegeospatial datapfaplay fairway analysisthermal qualitycross-section

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Utah FORGE: Roosevelt Hot Springs Analytical Well-Based Temperature Model Data

Dec 07, 2018
8.25 kB
Publicly accessible
This submission contains a cumulative record of one-dimensional temperature modeling based off of well data in the vicinity of the Utah FORGE site. Temperature log data from wells used, and in some cases were extrapolated below the bottom of a number of wells. The data were corre...
Authors
Podgorney, R. and Allis, R. Idaho National Laboratory
geothermalenergytemperature modelstudent competitionforgeutahroosevelt hot springs1dtemperaturemodelmodelingwell-basedegsmilfordutdataearthutah forgemodellingwell datatemperature datacharacterizationgeoreferenced datageospatial dataresourceprocessed data

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Publicly accessible
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service