OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 31.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"seismic sensing"×
Drilling and Completion×

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Exploration Best Practices on OpenEI

Sep 20, 2013
63.84 kB
Publicly accessible
This is an electronic database detailing different types of, various phases of, best practices for, and cost and time associated with geothermal exploration techniques. The groups of exploration techniques included in the database are Data and Modeling Techniques, Downhole Techniq...
Authors
Young, K. National Renewable Energy Laboratory
geothermalexplorationgeophysicsopeneiremote sensingconceptual modelsexploration costsbest practicesloggingdrillinggeochemistryresistivity surveymt surveyelectromagnetic surveygravityseismicisotopelidarhyperspectralmultispectralswirflirinsarsarreflectionrefractonmagneticsdc resistivity2-m probewell loggingdatabase link

Map of Validation of Innovative Exploration Technologies for Newberry Volcano

Jul 01, 2012
3.18 MB
Publicly accessible
A map showing location of wells permitted, drilled and seismic test, as part of validation of innovative exploration technologies done for the Newberry Volcano project in 2012.
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalmapsdrillingnewberryoregonvolcanocalderaexplorationdavenportmapietwelllocationpermitsseismicwell locationhydrothermalegs

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Utah FORGE: Borehole Sensors and Well Trajectories (April 2022)

Dec 23, 2022
Size unavailable
Publicly accessible
This link leads to a webpage with spreadsheets containing seismic borehole sensor locations and well trajectories for wells 56-32, 58-32, 78-32, 78B-32. Each of the files at the provided link include meta data on relevant information.
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeseismic sensorsborehole sensorswell trajectorieswell 58-32well 56-32well 78-32well 78b-32well trajectorycharacterizationwell datasensor datawellboredrillingexcelforgeegs

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

2011 Glass Buttes Exploration and Drilling

Jan 01, 2011
1.27 MB
Publicly accessible
2011 Geothermal Technologies Program Peer Review Presentation summarizing relevance, proposed approach, and logistics of the Glass Buttes Exploration and Drilling.
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermalalterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidarhyperspectralgravitymineral assemblages3d geologic modelfield workexplorationdrilling

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Utah FORGE: 2024 Annual Report on Activities and Advancements

Jan 27, 2025
19.87 MB
Publicly accessible
This 2024 annual report for Phase 3B Year 2 at Utah FORGE provides an in-depth account of activities and advancements made at the site. Key achievements include drilling and stimulating the production well 16B(78)-32, creating a geothermal reservoir, and achieving commercial-scale...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgephase 3byear 2yearly reportreportutah forge reportdrillingreservoir creationutah forge phase 3b report2024 annual reportegswell 16b78-32stimulationcirculationfiber optic monitoringdrilling technologiesseismic monitoringresearch and developmenttechnical reportannual report

Guelph, ON Canada DTS Metadata

Dec 15, 2014
290.13 kB
Publicly accessible
Metadata for active distributed temperature survey (DTS) experiments at Guelph, Ontario Canada. This data that this metadata refers to was taken as part of the PoroTomo project. The metadata includes information about status, location, elevation, units, and other metadata.
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperaturemetadatadistributed temperature surveyporotomodistributed temperature sensingcaoncanadaontarioguelphlocationelevationwelldrillingdepth

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

Hotspot Project: The Snake River Geothermal Drilling Project Initial Report

Jan 01, 2012
1.71 MB
Publicly accessible
The Snake River volcanic province (SRP) overlies a thermal anomaly that extends deep into the mantle; it represents one of the highest heat flow provinces in North America. The primary goal of this project is to evaluate geothermal potential in three distinct settings: (1) Kimama ...
Authors
Shervais, J. et al Utah State University
geothermalhotspot projectbasaltgeophysicalkimamakimberleygravitymagneticseismicloggingidahoaquifersnake rivervolcanic provinceplainhotspotexplorationrhyolitedrillingdownholelithologylithologic logstratigraphic column

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

Geothermal Exploration Cost and Time

Feb 13, 2013
14.89 kB
Publicly accessible
This paper describes the methodology used to define the baseline exploration suite of techniques (baseline), as well as the approach that was used to create the cost and time data set that populates the baseline. The resulting product, an online tool for measuring impact, and the ...
Authors
Jenne, S. National Renewable Energy Laboratory
geothermalcosttimeexplorationgeophysicsgeochemistrydrillingremote sensingeconomic

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Utah FORGE: Video of Utah FORGE Drilling Planning for Production Well 16B(78)-32

Mar 03, 2023
10.06 MB
Publicly accessible
This is a YouTube video containing the specifics of well planning for Utah FORGE 16B(78)-32. This well will be drilled as a doublet approximately 300 feet parallel to and above 16A(78)-32 and will be drilled between approximately April 15th and July 17th 2023.
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergywell planningutah forgewell 16b78-32well planning videoegsdrillingdoublet pairfiber opticstress measurementvibrationsinjection testingcirculation testingprocessed data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service