OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 588.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"temperature profiles"×

Maine Geological Survey Borehole Temperature Profiles

Nov 06, 2013
153.45 kB
Publicly accessible
This dataset includes temperature profiles from 30 boreholes throughout Maine that were selected for their depth, location, and lithologies encountered. Depths range from about 300 feet to 2,200 feet. Most of the boreholes selected for measurement were completed in granite becau...
Authors
Marvinney, R. Arizona State Geological Survey
geothermaltemperatureprofilesmainebedrockshapefileboreholegeospatial data

Effective Elastic and Neutron Capture Cross Section Calculations Corresponding to Simulated Fluid Properties from CO2 Push-Pull Simulations

Mar 07, 2018
4.46 MB
Publicly accessible
The submission contains a .xls files consisting of 10 excel sheets, which contain combined list of pressure, saturation, salinity, temperature profiles from the simulation of CO2 push-pull using Brady reservoir model and the corresponding effective compressional and shear velocity...
Authors
Chugunov, N. and Altundas, B. Lawrence Berkeley National Laboratory
geothermalenergyco2carbon dioxidepush-pullactive seismicwell loggingegsneutron capturesnuparstimulationsensitivity analysischaracterizationfaultfracturefluidbrine

Ground Source Heat Pump Computational Results

Jul 31, 2013
7.79 MB
Publicly accessible
This data submission includes simulation results for ground loop heat pump systems located in 6 different cities across the United States. The cities are Boston, MA, Dayton, OH, Omaha, NE, Orlando, FL, Sacramento, CA, and St. Paul, MN. These results were obtained from the two-dime...
Authors
Menart, J. Wright State University
geothermalground source heat pump systemscomputational resultsfull temperature field resultstemperature profileshome heating and cooling load informationsacramento cast. paul mn.boston maomaha neorlando fldayton oh

Ground Source Heat Pump Computational Results

Jul 31, 2013
7.79 MB
Publicly accessible
This data submission includes simulation results for ground loop heat pump systems located in 6 different cities across the United States. The cities are Boston, MA, Dayton, OH, Omaha, NE, Orlando, FL, Sacramento, CA, and St. Paul, MN. These results were obtained from the two-dime...
Authors
Menart, J. Wright State University
geothermalground source heat pump systemcomputational resultsfull temperature fieldssimulationground source heat pump systemstemperature profileshome heating and cooling load informationsacramentocast. paulmn.bostonmaomahaneorlandofldaytonoh

Analyzed DTS Data, Guelph, ON Canada

Jul 01, 2015
4.73 MB
Publicly accessible
Analyzed DTS datasets from active heat injection experiments in Guelph, ON Canada is included. A .pdf file of images including borehole temperature distributions, temperature difference distributions, temperature profiles, and flow interpretations is included as the primary analyz...
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperatureguelphimagespressuregradientwelldrill-holecodeontariocamatlab

Nevada Great Basin Play Fairway Analysis Reports & Appendices

Oct 28, 2015
52.81 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. et al Nevada Bureau of Mines and Geology
geothermalnevadaplay fairwayreportappendicesgreat basinnbmgnvpfacarson sinksteptoe valleygeophysicsgeophysicalgeologygeologiclidargeochemicalgravityseismic reflectionmtmagnetotelluricsgeodeticgeodesyshallow temperaturesoil gasslip and dilation tendancy3d modelingthermal modelingexplorationresource assessmentresource potentialinvestigationsurveypreliminarysite assessmentfavorabilitynv great basin

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

Snake River Plain Play Fairway Analysis: Mountain Home Geothermal Area Natural State Model

Jul 28, 2015
19.23 MB
Publicly accessible
The Mountain Home area is characterized by high heat flow and temperature gradient. Temperature data are available from 18 boreholes with depths equal to or greater than 200 m, 5 of which have depths ranging from ~1340 m to ~3390 m (MH-1, MH-2, Bostic1, Lawrence D No.1, and Anschu...
Authors
Garg, S. et al Utah State University
snake river mountain home modelinggeothermalenergysnake river plainmountain homenumerical modelmagnetotelluricgravityplay fairwaynatural statethermal modelingmagnetotelluricsplay fairway analysissrpmtgeophysicsgeophysicaltemperaurepre-productionstatestructureresource assessmentpfamodellingnatural

Hourly Thermal Load Profiles for U.S. Manufacturing Subsectors

Apr 24, 2026
3.92 MB
Publicly accessible
This dataset includes a consistent framework of annual, quarterly, and hourly energy demand and operational profiles for 63 U.S. manufacturing subsectors defined by NAICS classification, building on the county-level demand dataset "Updated U.S. Low-Temperature Heating and Cooling ...
Authors
Oh, H. et al National Laboratory of the Rockies
geothermalenergythermal energy demandindustrial energy demandmanufacturingu.s. manufacturingnaicseia mecsqpchourly load profilesoperating schedulescapacity utilizationprocess heatingprocess coolingrefrigerationboiler usefacility heatingfacility coolingend-use energyfuel typeprocessed data

Fallon FORGE: Seismic Reflection Profiles

Jan 01, 2015
14.3 MB
Publicly accessible
Fourteen seismic reflection profiles and their interpretations for the southern Carson Sink within and proximal to the proposed Fallon FORGE site. Five profiles were provided by the Navy Geothermal Program Office and reprocessed by Optim Inc. Nine proflies were acquired from the S...
Authors
Blankenship, D. Sandia National Laboratories
geothermalseismic profilescarson sinkfallonnevadaforgeseismicreflectiongeophysicstracesfaultdepth convertedinterpretedcontactsnvinterprettedinterpretationsei

Alum Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
252.81 MB
Publicly accessible
Data generated from the Alum Innovative Exploration Project, one of several promising geothermal properties located in the middle to upper Miocene (~11-5 Ma, or million years BP) Silver Peak-Lone Mountain metamorphic core complex (SPCC) of the Walker Lane structural belt in Esmera...
Authors
Miller, C. Ram Power, Inc.
geothermalgravitymagneticsmtgeochemistryregional temperatureresource modelwell datageologyupper miocenesilver peaklone mountainwalker lanealumesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countygrav-magmagnetic3dprofileprofilesround 12009round 22010magnetotelluricsinversion30 ohm100 ohm300 ohmztemchemistrygeothermometrytemperaturehole 56-29historicshallowwell logsmoderngeologicgeomechanicsgeophysical25-2926-19geologyreportexecutive summarymapssectionsphotosphotographspicturesgeospatial data

Utah FORGE: Temperature Contours at 200 m

Feb 01, 2016
19.09 kB
Publicly accessible
The individual shapefiles in this dataset delineate estimated temperature contours (20, 40, 60, and 80 deg C) at a depth of 200 m in the Milford, Utah FORGE area. Contours were derived from 86 geothermal, gradient, and other wells drilled in the area since the mid-1970s with dept...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmilfordforgeutahegstemperature200 mcontour20406080shapefileshape filearcgisgisgeospatial datautah forgeresourcecharacterizationroosevelt hot springscontoursprocessed datamineral mountainscove fortwell data

Cape EGS: Gold 2-P Pre-Drilling Geologic Characterization

Aug 15, 2024
2.32 MB
Awaiting release
This document provides a pre-drill prognosis for the Gold 2-P well at Fervo's Cape Project site, highlighting temperature and lithology projections. Elements include well trajectory schematics, a temperature-depth profile, and geologic cross sections. The temperature is estimated...
Authors
Dadi, S. Fervo Energy
geothermalenergygeologysite characterizationpre-drillprognosistemperature profilewell trajectorylithologygoldgold 2-pcapecape projectfervocape egsmilfordutahutah forge

Cape EGS: Gold 2-IB Mass Spectrometry and Mudlogs

Apr 30, 2025
6.61 MB
Awaiting release
This dataset contains logs and summaries from the Gold 2-IB well at the Cape EGS site near Utah FORGE, collected during operations in fall 2024. The dataset includes a mass spectrometry log, mudlog, measurement while drilling (MWD) data, and daily geology summaries. The mass spect...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergymass spectrometrymudlogegscape egsgold 2-ibgoldmwddrilling logsutah forgegas analysisraw datalithologywell loggingdepth profileslasrock cuttingsdrilling data

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

District Geothermal Energy Systems with Seasonal Underground Thermal Storage: Load Profiles, Modeling Workflow, and Techno-Economic Results for U.S. Screening

Sep 27, 2025
135.99 MB
Publicly accessible
This dataset accompanies the paper "Geothermal district energy systems coupled with seasonal underground thermal energy storage: a U.S. techno-economic screening by climate and geology." It contains the data and scripts required to reproduce the study's results across ten U.S. cit...
Authors
Mello, S. et al National Laboratory of the Rockies
geothermalenergydistrict energy systemsunderground thermal energy storageutesatesrtesground heat exchangerghesutratecho-economic analysisenergy modelingcomstockbuilding load profileslcoeaquifer storageseasonal storageu.s. citiespythonmodelscriptsmodel datasubsurface simulationgeotescold utes

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin

West Flank Coso FORGE: Seismic Reflection

May 16, 2016
14.82 MB
Publicly accessible
PDFs of seismic reflection profiles 101,110, 111 local to the West Flank FORGE site. 45 line kilometers of seismic reflection data are processed data collected in 2001 through the use of vibroseis trucks. The initial analysis and interpretation of these data was performed by Unru...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgewest flankseismic reflectionsurvey mapwaveprestack kirchoff migrationseismic profilescososeismicgeophysicscalifornia

Utah FORGE: Well 16B(78)-32 Pressure-Temperature Logs March April 2024

Apr 20, 2024
169.22 MB
Publicly accessible
This dataset consists of Baker Hughes Pressure-Temperature gauge readings on fiber optics in Utah FORGE Well 16B(78)-32. This gauge is at a measured depth of 7,056.67 feet. The true vertical depth can be determined from the well survey data, which is linked below. The data consis...
Authors
McLennan, J. and Hughes, B. Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16b78-32well 16butah forgebaker pressure temperature logspressure temperaturetemperaturepressurewell 16b78-32 pressure temperature logswell 16b78-32 temperature logswell 16b78-32 pressure logsfiber opticsbaker hughes

West Flank Coso FORGE: ArcGIS Data for Geologic Model

Mar 01, 2016
154.12 kB
Publicly accessible
Archive of ArcGIS data from the West Flank FORGE site located in Coso, California. Archive contains the following eight shapefiles: Polygon of the 3D geologic model (WestFlank3DGeologicModelExtent) Polylines of the traces 3D modeled faults (WestFlank3DModeledFaultTraces) Polyline...
Authors
Sandia National Laboratories
geothermalforgewest flankegscosoarcgis datacross-sectionseismic reflectionwell pathwell collarfault tracewell pathswell collarsgeospatial datamodelgeologygeologicfaulttracecalifornia

Development of a Downhole Tracer and pH Measurement Instrument for Application in Geothermal Wells

Sep 11, 2013
1.8 MB
Publicly accessible
Due the high temperature and pressure conditions found in geothermal wells, tracer studies designed to elucidate properties of geothermal reservoirs are traditionally conducted by pulling liquid samples from the wellhead. These samples are then sent off for analysis in a fixed lab...
Authors
Hess, R. et al Sandia National Laboratories
geothermaltracerhigh-temperaturesensorphion selective electrodesdownhole

Fallon FORGE: Seismic Reflection Profiles

Feb 01, 2018
33.35 MB
Publicly accessible
Newly reprocessed Naval Air Station Fallon (1994) seismic lines: pre-stack depth migrations, with interpretations to support the Fallon FORGE (Phase 2B) 3D Geologic model. Data along seven profiles (>100 km of total profile length) through and adjacent to the Fallon site were re-...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallonnevadaseismicreflectionvetted-nodepth migrationgeophysicsprocessed dataprestackinterpretedsite mapsurvey mapreprocessed datareprocesseddata

Utah FORGE 2-2446: Characterizing Stress Roughness Through Simulation of Hydraulic Fracture Growth

Jan 30, 2025
2.55 MB
Publicly accessible
This dataset covers work that investigated the apparent toughness anisotropy at Utah FORGE by comparing microseismic data with stress profiles from field measurements. The study analyzes the hydraulic fracture growth of Stage 3 at Well 16A(78)-32 using MEQ data, calibrating a nume...
Authors
Cusini, M. and Fei, F. Lawrence Livermore National Laboratory
geothermalenergyutah forgestress roughnesshydraulic fracturingmeqegsstress profilefield measurementshydraulic fracture growth16a78-32stage 3geostechnical reportprocessed datageophysics2-2446toughness anisotropyrock mechanics

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service