OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 124.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"well test data"×
Drilling and Completion×

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

Utah FORGE: Logs and Data from Deep Well 58-32 (MU-ESW1)

Apr 11, 2018
2.24 GB
Publicly accessible
Data, logs, and graphics associated with the drilling and testing of Utah FORGE deep test well 58-32 (MU-ESW1) near Roosevelt Hot Springs.
Authors
Nash, G. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutahgeothermal welltest welldrillinggeothermal drillingdrilling datawell testingwell test datafmi logsdsi logsgamma logsporositycaliper logsdaily reportstemperature logspressure logsisolation scannersonic logsmud logsdirectional surveypason logsborehole stresspt reportswell logsmu-esw158-32roosevelt hot springslogdatadeppwellcaliperegswell logtestingmilfordwell dataresourcecharacterizationtemperaturepressuredeep wellpason dataeowrend of well report

Utah FORGE: Well 14-2 Logs and Data from Roosevelt Hot Spring Area

Mar 03, 2016
96.02 MB
Publicly accessible
This is a compilation of logs and data from Well 14-2 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. Data includes: flowmeter survey (1989), geochemistry (1977-1978, 1977-1983), injection test data (1979, 1982), and spinner surveys (19...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsroosevelt hot springutah geothermal wellsutah well logswell logsgeothermal wellsgeothermal well logsutah egsgeophysicsdownholeboreholemud logspinner surveyinjection testgeochemistryflowmeter testsonicgammaporositytemperaturepressuresurveysubsurfaceinductioncalipercompensated neutronformation densityutahwell datawell log14-2resourcecharacterizationmilfordroosevelt hot springsflowmeterspinnergamma raycompensatedneutronformationdensityelectricsteam injection

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Life Cycle Water Consumption and Water Resource Assessment for Utility-Scale Geothermal Systems: An In-Depth Analysis of Historical and Forthcoming EGS Projects

Aug 31, 2013
10.97 MB
Publicly accessible
This report is the third in a series of reports sponsored by the U.S. Department of Energy Geothermal Technologies Program in which a range of water-related issues surrounding geothermal power production are evaluated. The first report made an initial attempt at quantifying the li...
Authors
Schroeder, J. et al Argonne National Laboratory
geothermalegswaterlife cyclewater consumptionpowerregional water resource assessmentstimulationinternationaldomesticgeologypermitnevadaproductioninjectioncaliforniaoregonoperationalabovegroundmake-upcoolingwellobservation wellnepadrillingproduction wellinjection wellchemicalflow testcirculation testexploration welllossreservoir lossbelowground lossoperational lossloss ratelife cycle assessmentwater resource

Microhole drilling technology utilizing a golden section search algorithm

Jun 23, 2021
812.35 MB
Publicly accessible
A fundamental issue in microhole drilling is that delivering high weight-on-bit (WOB), high torque rotational horsepower to a conventional drill bit does not scale down to the hole sizes necessary to realize the envisioned cost savings An optimization algorithm called a golden sec...
Authors
Su, J. et al Sandia National Laboratories
geothermalpercussive hammerweight-on-bitoptimizationmicroholesslimholesdrillingexplorationmonitoringtechnical assessmentfeasibilitywobgssgolden section searchalgorithmblue canyon domenew mexico tech energetic materials research and testing centersocorronew mexico

Geothermal Exploration of Newberry Volcano, Oregon Summary Report

Jan 01, 2015
64.62 MB
Publicly accessible
Abstract: Davenport Newberry (Davenport) has completed 8 years of exploration for geothermal energy on Newberry Volcano in central Oregon. Two deep exploration test wells were drilled by Davenport on the west flank of the volcano, one intersected a hydrothermal system; the other ...
Authors
Waibel, A. et al Southern Methodist University
geothermalnewberrynewberry volcanodavenportaltarockexplorationdrillinginvestigationsitestructuralblind geothermal systemvolcanicterrainoregoniet

Data of High-Temperature Dynamic LCM Testing Setup

May 31, 2021
9.94 MB
Publicly accessible
Data from high temperature dynamic sealing tests for various fracture widths, at various temperatures (degrees F), with 5 wt.% bentonite-based mud containing various material fiber contents, at 100 to 400 psi differential pressure. Data from pressure test and evaluation of the dy...
Authors
Magzoub, M. et al University of Oklahoma
geothermal drillinglost circulationshape memory polymergranitefractureswellbore strengtheningsealabilitygeothermalenergylost circulation materialssealing pressurefiltrationsmart lcmsmpfracture sealingdrilling fluid additivestemperaturemodeldrillingwellboreexperimenttechnologyprocessed data

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

Auto Indexer Auto-Indexer for Percussive Hammers: Vane Motor Dynamometer Testing

Jan 01, 2012
73.8 kB
Publicly accessible
Objectives Options associated with geothermal drilling operations are generally limited by factors such as formation temperature and rock strength. The objective of the research is to expand the "tool box" available to the geothermal driller by furthering the development of a hig...
Authors
Su, J. Sandia National Laboratories
geothermaldrillinghigh-temperature toolsauto indexerair-driven vane motordynamometerhigh temperature drilling motorpercussive hammerdown-the-hole-hammerhigh temeprature drillingdirectional drilling

Devices Suitable for Sectional Isolation Along Both Cased and Open-hole Wellbores Large-scale Test Setup

Jan 31, 2023
5.25 MB
Publicly accessible
The main goal of this project is to develop an annular isolation system capable to withstand geothermal downhole conditions and mitigate the problems experienced by conventional packers in FORGE wells. This large-scale set-up report is about the system that has been constructed to...
Authors
Teodoriu, C. et al Welltec
geothermalenergywellborecasingdrillingtechnicalassessmentstimulationforgeegs

Utah FORGE: Well 16A(78)-32: Summary of Drilling Activities

Mar 20, 2021
10.48 MB
Publicly accessible
This is a 74 page detailed summary of the drilling activities of Utah FORGE 16A(78)-32, a highly deviated well completed on February 2nd, 2021, as part of the Utah FORGE project. This well was deviated at 65 degrees from vertical after reaching 6000 feet in depth had a total measu...
Authors
Winkler, D. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32utah forgeforgeutah geothermaldeviated well 16a78-32deviated wellsegs16a78-32well datadrillingwell logcharacterizationdrill stem testroosevelt hot springsmilford

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Lost Circulation Materials in Geothermal Drilling: Thermal Degradation, Viscosity, Compression, and Flow Loop Tests

Feb 01, 2022
2.29 GB
Curated
This dataset provides a set of experimental data on the performance of lost circulation materials (LCMs) used in geothermal drilling operations. It includes results from four distinct tests: thermal degradation, viscosity measurements, compression tests, and high-temperature flow ...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergylost circulation materialslcmgeothermal drillingdrillingraw dataprocessed datamass loss measurementslost circulation managementdegradationthermal degradationdegradation patternrheologyfluiddrilliing fluidhigh temperatureflow testcompression testflow loop testsealingviscosity measurements

Utah FORGE: Well 82-33 Logs and Data, Roosevelt Hot Spring Area

Mar 03, 2016
74.2 MB
Publicly accessible
This is a compilation of logs and data from Well 82-33 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgeutah egsroosevelt hot springgeothermal well logswell logsutah well logsgeothermal wellsutah geothermal wellsroosevel hot springbottom hole pressurecasing schematiccleanoutsdirctional surveygeochemistrygeology loginjection cpaacitymorning reportsplan of operationsspinner surveyinjection testwater analysiswater chemistrycompensated soniccalipercement bondcollar logcompensated neutronformation densitydifferential temperaturegamma raymud loginductionpressure surveytemperature surveywell logwell data82-33utahresourcecharacterizationmilfordroosevelt hot springs

Devices Suitable for Sectional Isolation Along Both Cased and Open-hole Wellbores Pipe Preparation Report

Mar 31, 2023
3.14 MB
Publicly accessible
The main goal of this project is to develop an annular isolation system capable to withstand geothermal downhole conditions and mitigate the problems experienced by conventional packers in FORGE wells. This pipe preparation report is based on the test pipe that was procured and pr...
Authors
Teodoriu, C. et al Welltec
geothermalenergywellborecasingdrillingtechnicalassessmentstimulationforgeegs

Map of Validation of Innovative Exploration Technologies for Newberry Volcano

Jul 01, 2012
3.18 MB
Publicly accessible
A map showing location of wells permitted, drilled and seismic test, as part of validation of innovative exploration technologies done for the Newberry Volcano project in 2012.
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalmapsdrillingnewberryoregonvolcanocalderaexplorationdavenportmapietwelllocationpermitsseismicwell locationhydrothermalegs

Utah FORGE: Evaluation of Potential Geochemical Responses to Injection in the FORGE Geothermal Reservoir

Apr 03, 2019
324.78 kB
Publicly accessible
Plugging of fracture porosity from mineral precipitation due to injecting cold water into a a geothermal reservoir can impact the overall permeability of the fracture network in the reservoir. This can have serious ramifications on the efficiency of the geothermal resource. Geoche...
Authors
Patil, V. and Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyforge-utahgeochemistrynumerical modelingfractureinjection testporosityfracture networkmodelingwell 58-32well datastimulationdrillingroosevelt hot springswell 45-3reservoirmineralsthermalaqueousquartzcalciteillitekaolinitephpolythermalreaction pathutah forgeegsmilfordutahenergy geoscience institute

Microhole Test Data

May 23, 2016
226.52 kB
Publicly accessible
Drilling results from the microhole project at the Sandia High Operating Temperature test facility. The project is seeking to help reduce the cost of exploration and monitoring of geothermal wells and formations by drilling smaller holes. The tests were part of a control algorith...
Authors
Su, J. Sandia National Laboratories
geothermaldrillingmicroholehammerspercussionhothigh operating temperaturesandia

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Curated
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Utah FORGE: Well 16A(78)-32 Logs

Mar 08, 2021
10.01 GB
Publicly accessible
This dataset contains all well logs from Utah FORGE well 16A(78)-32. This includes the mud log, Sanvean Technologies logs, and Schlumberger logs. Please see the file descriptions below for information about each log.
Authors
Gilmour, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32 drilling logsutah forgeforgewell 16a78-32 sanvean logswell 16a78-32 schlumberger logswell 16a78-32 mud logutah geothermalwell dataloggingmud logsanvean logsschlumberger logs16a78-32well logegssanveanschlumbergerlithologyfmiformation microimagerfullborewellborecorecharacterizationdrillgeologydrill ratemineralstemperaturerate of penetrationropdrill stem test

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Utah FORGE: Well 16A(78)-32 Drilling Data

Jan 08, 2021
2.57 GB
Publicly accessible
This dataset includes survey data, drilling data, daily reports, summaries of daily operations, and rig photos from the drilling of Utah FORGE well 16A(78)-32, which is a highly deviated deep well. It was completed 60 days ahead of schedule. Rig move in began 10/22/2020 and dril...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedrillingdirectional16a78-32time seriessurveytrajectoryraw dataegsrigphotosoperationsdeviateddeep wellhighly deviatedforgeutahpasonpason data

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service