OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 30.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"research size assessment tool"×
Image×

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Utah FORGE: Targeting Geothermal Resources with Geodetic Strain Data Paper

Oct 01, 2004
Size unavailable
Publicly accessible
The paper linked below offers an initial assessment of a new method to target potential geothermal resources on the regional scale. The method is based on seeking relationships between geologic structures and geodetic observations of regional tectonic strain.
Authors
Blewitt, G. et al Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgestraingreat basin strainegsgeodetictensorsecond invariantgeodesynevadautahratecrustalgpsfaultorientationmagnitude

REopt Lite Geothermal Heat Pump Design Requirements

Mar 08, 2021
277.13 kB
Publicly accessible
This document describes the design requirements for the geothermal heat pump (GHP) module being added to the existing REopt Lite web tool. This document describes the purpose, users, and functional requirements to which the modified web tool shall conform. This document will be re...
Authors
Olis, D. National Renewable Energy Laboratory
geothermalenergyreoptreopt liteghpgeothermal heat pumpmodelmoduleweb toolweb interfacetooltechno-economiceconomics

Lost Circulation Materials in Geothermal Drilling: Single Fracture Clogging Experments

Jan 06, 2025
9.9 MB
In progress
The submitted dataset was generated by a series of laboratory fracture clogging (permeability reduction) experiments using commercially available materials used for lost circulation management during geothermal well drilling. The experiments were conducted using a permeability plu...
Authors
Lawrence Berkeley National Laboratory
geothermalenergydrillinglost circulation managementlost circulation materialsfractureclogginglaboratory experiment

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

EGS Collab Experiment 1: Temperature profile

Apr 01, 2019
18.7 MB
Publicly accessible
This submission includes an input file, plot file, Fortran conversion file, and 3D data file from the simulation of the temperature profile within the Test Bed #1 of the EGS Collab project. The simulation was executed with PNNL's STOMP-GT simulator, which reads the input file, and...
Authors
White, M. Pacific Northwest National Laboratory
geothermalenergysurfegs collabnumerical simulationstomp-gtdataegstemperaturedistribution3dwest access driftfortrancodesanford underground research facility

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Hawaii Play Fairway Analysis Results

Jan 01, 2015
36.15 MB
Curated
This dataset presents a geothermal resource probability grid for the state of Hawaii, produced as part of a Play Fairway Analysis conducted between. The analysis integrated geological, geophysical, and hydrological data to estimate the likelihood of resource presence based on subs...
Authors
Lautze, N. et al University of Hawaii
geothermalhawaiipfaanalysisresultsplay fairwayprobabilitygridresource assessmentresource potentialresource characterizationcharacterizationresourcegeospatial data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

End Use Load Profile (EULP) of US Building Sector resulting from mass GHP retrofits

Apr 15, 2023
239.96 MB
Curated
This collection of datasets describes the change (difference) in hourly energy consumption of the U.S. residential and commercial building stock while replacing existing HVAC systems with ground source heat pumps for all the balancing areas in the US, for all buildings eligible fo...
Authors
Liu, X. et al Oak Ridge National Laboratory
geothermalenergyeulpbuildingresidentialcommercialnationwideheat pumpghpend use load profiletechnicalassessmentlong-termprocessed data

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

West Flank Coso, CA FORGE Test Area

Nov 15, 2015
773.24 kB
Publicly accessible
A map with the Coso West Flank FORGE test area outlined, along with regional seismicity, the aeromagnetic data set and the area currently being utilized for the creation of the 3D model.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankforgegeographygeophysicscaliforniacososeismicityaeromagnetic

Snake River Plain FORGE: Well Data for USGS-142

Nov 23, 2015
19.78 MB
Publicly accessible
Well data for the USGS-142 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, and photos of rhyolite core samples. This collection of data has been assembled as part of the site characterization data used to develop ...
Authors
Twining, B. Idaho National Laboratory
geothermalforgeegscore sample photosrhyolitelithologysrgcsnake river plainidahotempaddendumboreholelogusgs 142core samplesphotospresentationxrf datawhole rocktrace-element analysisignimibritethin sectionpetrographicimagesnatural gammagamma radiationtemperature profileneutron porositygamma-gammadensitywell logsrpcore samplecore photosmineralogypetrographygeologystratigraphic columnstratigraphyxrfsrg

EGS Collab Experiment 1: Well Locations and Orientations.

Sep 05, 2018
657.91 kB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsigma-vsurfwell locationegsstimulationhydraulicfracturingtestbed 1west access driftsanford underground research facilityboreholesgeophysical monitoringreflex gyroorientationslaser/lidermagnetic orientation survey

EGS Collab Experiment 2: Preliminary Test Wells Locations and Orientations

Dec 19, 2019
233.95 kB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergysurfegs collabgyro datahydraulic fracturinghydraulic shearingsanford underground research facilitywell locationswellstestbed 2lidarremote sensingegsexperiment 2well locationwell orientationsigma-vtest wellswell dataleapfroghomestake mineboreholegyrocollar location

Utah FORGE: Optimization of a Plug-and-Perf Stimulation (Fervo Energy)

Feb 08, 2023
6.91 MB
Publicly accessible
Information around the plug-and-perf treatment design at Utah FORGE by Fervo Energy. Objective and Purpose: Develop a multistage hydraulic stimulation approach designed specifically to target the top three factors that control the technical and commercial viability of an EGS sys...
Authors
Norbeck, J. et al Fervo Energy
geothermalenergyutah forgeplug-and-perf stimulationwell stimulationfervo energyplug-and-perfplug and perffervotechnicalassessmentfeasibilityhydraulicstimulationinjection testprocessed datablue mountainnevadaegswell 73-22well 34a-22well 34-22near-field egshorizontal drillingproppantheat in placestate of stressfiber optic sensing

Fallon FORGE: Vs30m Seismic Velocity

Mar 12, 2018
3.53 MB
Publicly accessible
Time-averaged shear-wave velocity to 30 m depth about the Fallon, NV FORGE site.
Authors
Blankenship, D. and Kaven, J. Sandia National Laboratories
geothermalenergyforgeegsfallonseismicityvs30nevadashearwavevelocityvetted-nogeophysicsseismicnvs-wave

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

EGS Collab Experiment 2: Core Logs

Jul 08, 2019
1.36 GB
Publicly accessible
Core logs and photos from the EGS Collab project Experiment 2 for the Top Vertical well (TV4100) and the Top Horizontal well (TV 4100) on the 4100 Level of SURF (the Sanford Underground Research Facility). The core logs are stored in a single PDF file with 5-ft run intervals. In t...
Authors
Dobson, P. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegscore logcorefoldingfoliationwell datalogging

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service