OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 26.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"seismic moment"×
Image×

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

Directional Cooling-Induced Fracturing Westerly Granite Test Results

Dec 18, 2020
72.48 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on a short, cylindrical sample of Westerly granite (diameter = 4 inches, height ~ 2 inches). Liquid nitrogen was poured in a copper cup attached to the top of the sample, and the resulting acoustic emissions ...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalthermal crackingacoustic emissionstemperature changeslaboratory experimentwesterly granitegranitemoment tensorfractureseismicgeophysicsliquid nitrogenthermaltemperaturestimulationdirectional coolinginduced fracturingdirectional cooling-induced fracturingwellborestressvelocitytomographymicrocracking

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Walker Ranch 3D Seismic Images

Mar 01, 2016
836.05 kB
Publicly accessible
Amplitude images (both vertical and depth slices) extracted from 3D seismic reflection survey over area of Walker Ranch area (adjacent to Raft River). Crossline spacing of 660 feet and inline of 165 feet using a Vibroseis source. Processing included depth migration. Micro-earthqua...
Authors
J., R. Lawrence Livermore National Laboratory
geothermal3d seismic reflectionwalker ranchraft river3d seismicdepth slicenarrowsmeqmicroseismicitygeophysicsegsnarrows zoneactive source

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis

DCIF Westerly Granite AE Stress Effect Test (Task 3-1)

Jul 08, 2021
216.62 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on rectangular Westerly granite blocks (width=depth=4.0", height=2.0"). Liquid nitrogen was poured in a small, 1"-diameter copper cup attached to the top of the sample, and the resulting acoustic emissions (A...
Authors
Nakagawa, S. and Trzeciak, M. Lawrence Berkeley National Laboratory
geothermalenergythermal fracturingstress measurementfracturingprocessed datageophysicsstress testinggranitewesterly granitestressmicrofracturefracturedatatemperatureacoustic emissionacoustic emission locationacoustic emission rate

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

DCIF (Directional Cooling-Induced Fracturing) Westerly Granite AE Borehole Damage Effect Test (Task 3-0)

Jan 27, 2022
162.51 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on three rectangular Westerly granite blocks (width=depth=4.0", height=2.0") which were preheated to 200, 400, and 600 degree C to induce damage (microcracks) with varying degrees. Liquid nitrogen was poured...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalenergydirectional cooling induced fracturingdcifdirectional cooling-induced fracturingdamage effect testfracturemicrocrackthermal stressacoustic emissionaccousticsthermal fracturefailure testraw dataprocessed datastressbiaxial stresswesterly graniteborehole damage effecttestwesterlygranite

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Fallon FORGE: Vs30m Seismic Velocity

Mar 12, 2018
3.53 MB
Publicly accessible
Time-averaged shear-wave velocity to 30 m depth about the Fallon, NV FORGE site.
Authors
Blankenship, D. and Kaven, J. Sandia National Laboratories
geothermalenergyforgeegsfallonseismicityvs30nevadashearwavevelocityvetted-nogeophysicsseismicnvs-wave

EGS Collab Experiment 2: Continuous Broadband Seismic Waveform Data

Sep 12, 2022
17.77 MB
Publicly accessible
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. This dataset includes the NSF SAGE website where seismic waveform data from this experiment can be downloaded. Two broadband seismometers were installed...
Authors
Rodriguez Tribaldos, V. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegswaveformsbroadbandtiltcharacterizationseismicwaveformgeophysicsexperiment 2continuousmonitoring4100 level

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Project HOTSPOT: Mountain Home Well Borehole Geophysics Database

Nov 11, 2012
209.37 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainproject hotspotidahoyellowstone hotspotborehole geophysicsmountain homegeophysicsborehole logdowhnhole geophysicstemperaturepressuregamma raymagnetic susceptibilitygeochemistrythoriumuraniumpotassiumneutronresistivityimage logsrpboreholewell data

Utah FORGE 3-2417: Meteorological Data During 2023 Completion/Circulation

Jun 10, 2024
2.4 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the completion/cementing of well 16B(78)-32 and the initial 2023 circulation test, largely occurring in June/July/August of 2023. This information may p...
Authors
Ajo-Franklin, J. Rice University
geothermalenergyutahutah forgeegsenhanced geothermalmeteorological datameteorologywell 78-16circulationcompletiontemperaturewindhumidityprecipitationtime seriesraw datacalibrationinstrument calibration78-16

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Publicly accessible
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

PoroTomo Natural Laboratory Horizontal and Vertical Distributed Acoustic Sensing Data

Mar 29, 2016
342.13 TB
Publicly accessible
This dataset includes links to the PoroTomo DAS data in both SEG-Y and hdf5 (via h5py and HSDS with h5pyd) formats with tutorial notebooks for use. Data are hosted on Amazon Web Services (AWS) Simple Storage Service (S3) through the Open Energy Data Initiative (OEDI). Also include...
Authors
Feigl, K. et al University of Wisconsin
geothermalporotomodasfiber opticsurface sensorsseismic arraydistributed acoustic sensingporoeleastic tomographybradys geothermal fieldgeosciencedistributed sensingdownholetrenchedseismicityhydrothermalgeophysicsoediraw datajupyter notebookpythonhdf5hsdsh5pyh5pyd
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service