OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 458.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"point data"×
EGS×

EGS Collab Experiment 2: Laser Scanned 4100 L Drift Map

Dec 19, 2019
1.26 GB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergylaser scanned drift mapsurfegs collabhydraulic shearingsanford underground research facilityhydraulic fracturingegslaser scanneddrift mapyates shaftbattery charging stationlaser surveytestbed 2experiment 2autocadleapfrogpoint cloudmapremote sensing

Utah FORGE: Regional Well Locations

Feb 22, 2018
7.42 kB
Publicly accessible
This archive contains a GIS point feature shapefile that shows the locations of wells in the general region of the Utah FORGE project, near Roosevelt Hot Springs. This includes Utah FORGE deep well 58-32 and wells for which data has been uploaded to the Geothermal Data Repository....
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgewellsspatial datagis datashapefilewell locationsroosevelt hot springswell indexarcgisgeospatial datawelllocation58-32utahegsmilfordregionalwell location

Recovery Act: Microhole Tubing Bending Report

Jan 01, 2012
Size unavailable
Publicly accessible
A downhole tubing bending study was made and is reported herein. This study developed a model to predict the shape of the pipe at downhole conditions and determines if the various pipe string sizes can reach a specified landing depth. The wellbore trajectory is described by this s...
Authors
Ruan, C. Impact Technologies LLC
geothermaltubingdrill pipedrillingmicroholemicroboretubing bendingwell constructionmodelabrasive slurryjet technologyegs

Fallon FORGE: LiDAR Acquisition and Processing Report

May 23, 2016
35.38 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes LiDAR from the Navy GPO. Also included are geologic maps from the USGS and Nevada Bureau of Mines and Geology for the Fallon, NV area.
Authors
Bucher, K. et al Sandia National Laboratories
geothermallidarforgeegsfallonnevadanas fallonnavy gpogeologyremote sensingreportprocessingacquisition

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

Fallon FORGE: 3D Geologic Model

Mar 01, 2018
949.28 kB
Publicly accessible
The 3D geologic model for the Fallon for site was constructed in EarthVision software using methods similar to (Moeck et al., 2009, 2010; Faulds et al., 2010b; Jolie et al., 2012, 2015; Hinz et al., 2013a; Siler and Faulds, 2013; Siler et al., 2016a, b) References are included in ...
Authors
Blankenship, D. and Siler, D. Sandia National Laboratories
geothermalenergyforgeegsgeologymodelearthvisionfaultsstratigraphyvetted-no3dfallonnv3d modelingfaultingstructurenevadamodellinggeologic

AASG Wells Data for the EGS Test Site Planning and Analysis Task

Oct 09, 2013
32.16 MB
Publicly accessible
Temperature measurement data obtained from boreholes for the Association of American State Geologists (AASG) geothermal data project. Typically bottomhole temperatures are recorded from log headers, and this information is provided through a borehole temperature observation servic...
Authors
Augustine, C. National Renewable Energy Laboratory
geothermalwelltemperatureegs test sitebottomholeshpboreholeborehole temperaturedataegsgeospatial data

Utah FORGE 3-2535: Building a 3D Resistivity Model for Simulation and Survey Design of EM Measurements

Dec 01, 2022
3.23 MB
Publicly accessible
The included report outlines the creation of three 3D resistivity models that will be used to determine the sensitivity of EM measurements for the hypothetical stimulated reservoir at FORGE as well as for EM survey design. FORGE project 3-2535 is planning on using a casing source ...
Authors
Alumbaugh, D. et al Lawrence Berkeley National Laboratory
geothermalenergyutah forgeegsforgemodelingresistivity modelremote sensingwell characterizationwell 16awell 16b

Newberry EGS Seismic Velocity Model

Oct 01, 2013
4.2 MB
Publicly accessible
We use ambient noise correlation (ANC) to create a detailed image of the subsurface seismic velocity at the Newberry EGS site down to 5 km. We collected continuous data for the 22 stations in the Newberry network, together with 12 additional stations from the nearby CC, UO and UW ...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsvelocityreservoirseismic velocitycross-correlationmodelgeophysicsnewberry

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

Utah FORGE: Area 0.5 m LiDAR Data

Oct 01, 2016
Size unavailable
Publicly accessible
During the Fall of 2016 AGRC and the Utah Geological Survey acquired ~205 square miles of 8 points per meter Quality Level 1 LiDAR of The Frontier Observatory for Research in Geothermal Energy (FORGE) area around Milford, Utah in Beaver and Millard Counties in western Utah. The 0....
Authors
Allis, R. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgedemdsmdigital elevation modeldigital surface modelegsenhanced geothermal systemsfrontier observatory for research in geothermal energyroosevelt hot springsutlidargeospatial datagisremote sensingutahdatamilford

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

EGS Collab Experiment 1: Temperature profile

Apr 01, 2019
18.7 MB
Publicly accessible
This submission includes an input file, plot file, Fortran conversion file, and 3D data file from the simulation of the temperature profile within the Test Bed #1 of the EGS Collab project. The simulation was executed with PNNL's STOMP-GT simulator, which reads the input file, and...
Authors
White, M. Pacific Northwest National Laboratory
geothermalenergysurfegs collabnumerical simulationstomp-gtdataegstemperaturedistribution3dwest access driftfortrancodesanford underground research facility

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Simulations of Brady's-Type Fault Undergoing CO2 Push-Pull: Pressure-Transient and Sensitivity Analysis

Mar 09, 2018
9.74 MB
Publicly accessible
Input and output files used for fault characterization through numerical simulation using iTOUGH2. The synthetic data for the push period are generated by running a forward simulation (input parameters are provided in iTOUGH2 Brady GF6 Input Parameters.txt [InvExt6i.txt]). In gene...
Authors
Jung, Y. and Doughty, C. Lawrence Berkeley National Laboratory
geothermalenergyegsco2carbon dioxidepush-pullpressure-transient testingitough2sensitivity analysisinverse modelingparameter estimationinconpesttough2fault modelinggf6bradyfaultingfaultfracturecharacterizationstimulation

EGS Collab Experiment 1: Second Set Tracer Test Results

Dec 19, 2019
4.94 MB
Publicly accessible
The EGS Collab project is developing ~10-20 m-scale field sites where fracture stimulation and flow models can be validated against controlled, small-scale, in-situ experiments. The first multi-well experimental site was established at the 4850 level in the Homestake Mine in Lead,...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsurftracer testssigma-vc-dotsrhodamine-bfluoresceinbreakthrough curvechloridetracer datahydraulicfracturingsimulationtracerexperimentalegssanford underground research facilityinjectionsodium chloridelithium bromidecesium iodinetestbed 1stimulation

Utah FORGE: Slide-Hold-Slide Experiments on Gneiss at Increased Temperature

Jul 25, 2023
4.1 GB
Publicly accessible
Included are data from triaxial, single-inclined-fracture friction experiments. The experiments were performed with slide-hold-slide protocol on Utah FORGE gneiss at increased temperature. With a ~10 MPa normal stress, temperatures vary between experiments from room temperature u...
Authors
Eijsink, A. and Elsworth, D. Pennsylvania State University
geothermalenergyfrictionsingle inclined fractureslide-hold-slideacoustic dataacoustic emissionpassive acousticgeophysicsfracturereactivationgneissutah forgeegsfriction dataactive acousticvelocity data

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

Brady's Geothermal Field March 2016 Vibroseis SEG-Y Files and UTM Locations

Mar 31, 2016
982.28 GB
Publicly accessible
PoroTomo March 2016 Updated vibroseis source locations with UTM locations. Supersedes gdr.openei.org/submissions/824. Updated vibroseis source location data for Stages 1-4, PoroTomo March 2016. This revision includes source point locations in UTM format (meters) for all four Stage...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisegsactive seismicsurveymetadatasweep datasource locationsutmactive sourcetruckgeophysicsgeophysicalsegyseismic datadasdasv

Utah FORGE: 2024 Discrete Fracture Network Model Data

Sep 08, 2024
1.4 GB
Publicly accessible
The Utah FORGE 2024 Discrete Fracture Network (DFN) Model dataset provides a set of files representing discrete fracture network modeling for the FORGE site near Milford, Utah. The dataset includes four distinct DFN model file sets, each corresponding to different time frames and ...
Authors
Finnila, A. and Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedfndiscrete fracture modellingfracturesstochastic fracturestensile fracturesdiscrete fracture network modelegsplanar fracturespermeabilityporositycompressibilitystoragemeqhydraulic stimulationmodelmodelingprocessed data
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service