OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 318.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"seismic array"×

Triggered MEQ Events on LBNL Permanent Seismic Array, Brady's EGS, March 2016

Jun 01, 2016
83.98 kB
Publicly accessible
List of triggered events recorded on LBNL's permanent EGS seismic array at Brady's geothermal field. This submission also includes links to the NCEDC EGS Earthquake Catalog Search page and to the metadata for the seismic array installed at Brady's Geothermal Field.
Authors
Robertson, M. University of Wisconsin
geothermalporotomoegsseismic monitoringseismic networkseismicitymicroseismicityinduced seismicitymeqbradybradys geothermal fieldbradys hot springsearthquake catalogearthquakestimulationgeophysicsgeophysicalseismic

Utah FORGE: Triggered 3-Component Surface Nodal Seismic Waveforms from the April 2022 FOAL 1 Experiment

Jun 30, 2026
736.6 MB
Publicly accessible
This package contains triggered 3-component surface nodal seismic waveforms recorded during the FOAL 1 experiment, or FORGE Observation Array Linear #1, which occurred during the April 2022 hydraulic stimulation of well 16A(78)-32 at the Utah FORGE EGS site. This data was utilized...
Authors
Kim, J. et al Rice University
geothermalenergyegsutah forgeforgemicroseismichydraulic stimulationfoal 1forge observation array linear16a32-32april 2022microseismicityinduced seismicitypassive seismic monitoringsurface nodal array3-component seismic datasmartsolominiseedstationxmlevent catalogwell trajectoryfogmoregeophysicsseismic dataprocessed data

Brady's Geothermal Field DAS and DTS Surface and Borehole Array Metadata

Mar 31, 2016
3.71 MB
Publicly accessible
This metadata submission includes the coordinates of the DAS and DTS surface and borehole arrays, the list of file names, and the list of recorded files during testing at the PoroTomo Natural Laboratory at Brady Hot Spring in Nevada. Testing was completed during March 2016.
Authors
Fratta, D. University of Wisconsin
geothermaldasdtsfiber opticseismic arraytemperature arrayssurface sensorsborehole sensorscoordinatesfile listingfile listdata collection gapsdas datahorizontal arraymetadatautm coordinatesmetersborehole arrayboreholedistributed temperature sensingdistributed acoustic sensingseismic monitoringpassive monitoringgeophysics

Brady's Geothermal Field DAS Earthquake Data

Mar 21, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the vibration caused by a 3.4 M earthquake and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. Data is available in the original .sgy formats, as well as in standardized .h5 formats. Earthquake information : M ...
Authors
Feigl, K. University of Wisconsin
geothermalbrady hot springsporotomoseismicdistributed acoustic sensingearthquakedashorizontalverticalgeophysicsmonitoringseismicityarraypassive sourcenveqinduced seismicityseg-yhdf5

Brady's Geothermal Field Reftek Seismometer Metadata

Mar 26, 2016
457.21 kB
Publicly accessible
Metadata for the Reftek seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatareftekseismometerseismicarraypassive seismicporotomobradygeophysicsmonitoringseismicity

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Utah FORGE: Ground Motion Study Report

Mar 16, 2018
3.11 MB
Publicly accessible
Paragon Geophysical contracted Urban Seismic Specialists to conduct A Ground Motion Study, on their Forge 3D project located near in Milford Utah .The test was conducted to measure the effects of the vibrator array on a pipeline owned by Kern River. Testing began November 22nd, an...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyground motionseismicearthquakeutah forgeforgeseismicityparticle motionppvmonitoringtestingsweep testingvibrator arraypeak particle velocityutahegsstudygeophysicsdemobilizationdemobilizingvibratorroosevelt hot springsmilfordreport

Active Source 3D Seismic Tomography of Brady Hot Springs Geothermal Field, Nevada

Aug 09, 2017
26.79 MB
Publicly accessible
We deployed a dense seismic array to image the shallow structure in the injection area of the Brady Hot Springs geothermal site in Nevada. The array was composed of 238 5 Hz, three-component nodal instruments and 8,700 m of distributed acoustic sensing (DAS) fiber-optic cable inst...
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadaseismic tomographyactive sourceporotomobrady geothermal fieldbradysshallowseismic imagingporoelastic tomography

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

Imperial Valley Dark Fiber Project (IVDF): Brawley EQ Cluster Catalog and DAS Event Dataset

Apr 08, 2026
4.13 GB
Publicly accessible
The Imperial Valley Dark Fiber (IVDF) project deployed a distributed acoustic sensing (DAS) interrogator on a pre-existing dark fiber cable running ~28 km between Calipatria and Imperial, California, passing through the Brawley Geothermal Field and surrounding Brawley Seismic Zone...
Authors
Ajo-Franklin, J. et al Rice University
geothermalenergydasdistributed acoustic sensingfiber optic sensingbrawley seismic zonesalton seaimperial valleybrawley fieldearthquakeseismicityevent cataloghdf5southern california seismic networkscsnwaveform recordingsswarmraw dataprocessed datageophysics

Brady's Geothermal Field Reftek Seismometer Data

Mar 30, 2016
Size unavailable
Publicly accessible
Continuous seismic recordings from six Reftek seismometers deployed at Bradys Hot Springs geothermal field in Nevada from March 9th to 30th, 2016. Data is archived in mseed format. Five of the six stations are under a moratorium.
Authors
Feigl, K. University of Wisconsin
geothermalporotomopassive seismicbradys hot springsnevadareftekseismometerseismicarraybradyseismicitymonitoringnvpassive source

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Full Moment Tensors and Stress Inversion Catalogs

Sep 26, 2018
51.03 kB
Publicly accessible
This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the P...
Authors
Gritto, R. et al Array Information Technology
geothermalenergyseismic moment tensorstress orientationstress changesinversiongeysersegsenhanced geothermalazimuthplungemincroseismicityinjectionstimulationreservoirthe geysershigh temperature reservoirfull mtsolutionspassiveseismicseismicitymicroseismicitymonitoringarraymomenttensorcataloganalysisinducedstressprati 32demonstrationfracturespatio-temporalgenerationresourcedevelopmenthydraulicfaultingfaultearthquakegeophysicsgeophysical

Brady's Geothermal Field Nodal Seismometers Metadata

Mar 28, 2016
279.97 MB
Publicly accessible
Metadata for the nodal seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing. Metadata includes location and timing for each instrument as well as file lists of data to be uploaded in a separate submission.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatanodalseismometersporotomobradys geothermal areaseismicarraymonitoringseismicitygeophysics

EGS Collab Experiment 2: Microseismic Monitoring

May 28, 2024
230 TB
Publicly accessible
This dataset contains continuous seismic waveform data recorded during stimulation and thermal circulation tests for the Enhanced Geothermal Systems (EGS) Collab Experiment #2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Da...
Authors
Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergymicroseismicwaveformcontinuous seismicstimulationcirculationsurf3caccelerometerhydrophoneborehole arrayegs collabraw datacontinuous waveformbinaryseedobspytechnical reportgeophysicsmicroseismicity

GEISER Project The Geysers Seismic Broadband Data 2012 2013

Oct 31, 2018
Size unavailable
Publicly accessible
This link points to the Northern California Earthquake Data Center (NCEDC) to access The Geysers seismic broadband data. The two available data sets consist of continuous waveform data recorded at The Geysers from July 2012 to July 2013 and a processed catalog with earthquake info...
Authors
Gritto, R. Array Information Technology
geothermalenergyseismic broadband dataseismicmicroseismiccontinuousinducedseismicitymicroseismicitymonitoringeventnetworkegsgeyserscacaliforniaarrivalearthquakegeisergeothermal engineering integrating mitigation of induced seismicity in reservoirsmitigationreservoirsstimulationresourcedevelopmenthydraulic

Utah FORGE: Development of a Reservoir Seismic Velocity Model and Seismic Resolution Study

Apr 30, 2022
15.3 MB
Publicly accessible
This is data from and a final report on the development of a 3D velocity model for the larger FORGE area and on the seismic resolution in the stimulated fracture volume at the bottom of well 16A-32. The velocity model was developed using RMS velocities of the seismic reflection su...
Authors
Vasco, D. and Chan, C. Array Information Technology
geothermalenergyseismic velocity modelseismic resolution3d p-wave3d s-waveseismicraw dataprocessed datawell 16a-32utah forge

Utah FORGE 3-2535: Preliminary Report on Development of a Reservoir Seismic Velocity Model

Jan 30, 2023
5.8 MB
Publicly accessible
This report describes the development of a preliminary 3D seismic velocity model at the Utah FORGE site and first results from estimating seismic resolution in the generated fracture volume during Stage 3 of the April 2022 stimulation. A preliminary 3D velocity model for the larg...
Authors
Gritto, R. Array Information Technology
geothermalenergy3d seismic velocity modelseismic resolutionseismicgeophysicsreservoirmodelvelocityforgeutah forgeegscharacterizationreportpreliminarymilfordphasenetneural networkingmachine learningdeep learning

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Brady's Geothermal Field Map of DAS, Nodal, Vibroseis and Reftek Station Deployment

Oct 15, 2016
1.62 MB
Publicly accessible
Map of DAS, nodal, vibroseis and Reftek stations during March 2016 deployment. The plot on the left has nodal stations labeled; the plot on the right has vibroseis observations labeled. Stations are shown in map-view using Brady's rotated X-Y coordinates with side plots denoting...
Authors
Feigl, K. University of Wisconsin
geothermalmapdeploymentbrady geothermal fieldegsporotomoseismic stationsdasdistributed acoustic sensingnodalseismometervibroseisreftekstationsbradybradys hot springsactive sourcepassive sourcedetectionmonitoringseismicgeophysicsboreholesurfacearraydownholeobservation locations

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service