OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 134.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"text file"×
Drilling and Completion×

Utah FORGE: Well 78B-32 Daily Drilling Reports and Logs

Aug 09, 2021
11.89 GB
Publicly accessible
This data set includes the daily drilling reports and Pason data for well 78B-32 and Schlumberger logs acquired after drilling completion. This well was drilled between June 27th and July 31st of 2021. Also included is raw and processed data for a variety of well data metrics incl...
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 78b-32well 78b-32 fmi logswell 78b-32 ubi logswell 78b-32 drilling datautah forge well 78b-32daily reportsdaily drilling reportsprocess dataraw datagamma rayporositylogscementtemperaturedensityresistivityfractureubifmisonicwell databoreholewelldatagammadrillingreportscblcement bond logpason data

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Utah FORGE: Well 16A(78)-32 Drilling Data

Jan 08, 2021
2.57 GB
Publicly accessible
This dataset includes survey data, drilling data, daily reports, summaries of daily operations, and rig photos from the drilling of Utah FORGE well 16A(78)-32, which is a highly deviated deep well. It was completed 60 days ahead of schedule. Rig move in began 10/22/2020 and dril...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedrillingdirectional16a78-32time seriessurveytrajectoryraw dataegsrigphotosoperationsdeviateddeep wellhighly deviatedforgeutahpasonpason data

Project HOTSPOT: Kimama Well Core and Drill Site Photos

Jan 16, 2011
106.28 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainkimamaphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data

Project HOTSPOT: Kimberly Well Core Photos

Jun 16, 2011
944.97 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalkimberlyproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data

Project HOTSPOT: Mountain Home Well Core and Drill Site Photos

Jan 11, 2012
937.4 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoyellowstone hotspotproject hotspotborehole geophysicsmountain homedrillingphoto core logdownhole geophysicsphotossrpcontinuous volcanismcore samplecore logwell datacore

Utah FORGE: Discrete Fracture Network (DFN) Data

Jun 24, 2020
10.65 GB
Publicly accessible
The FORGE team is making these fracture models available to researchers wanting a set of natural fractures in the FORGE reservoir for use in their own modeling work. They have been used to predict stimulation distances during hydraulic stimulation at the open toe section of well 1...
Authors
Finnila, A. and Podgorney, R. Golder Associates Inc.
geothermalenergyutah forgeforgeutah geothermalreservoirengineeringhydraulicfracturingegsdiscrete fracture networkdfnfracture modellingmilfordmodelingfracturehydroshearinflatedpore pressurestressfracmanstimulationdrillingpressuregoldersimulationreservoir planninghydraulic fracturing

Lost Circulation Materials in Geothermal Drilling: Single Fracture Clogging Experments

Jan 06, 2025
9.9 MB
In progress
The submitted dataset was generated by a series of laboratory fracture clogging (permeability reduction) experiments using commercially available materials used for lost circulation management during geothermal well drilling. The experiments were conducted using a permeability plu...
Authors
Lawrence Berkeley National Laboratory
geothermalenergydrillinglost circulation managementlost circulation materialsfractureclogginglaboratory experiment

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Cornell University Borehole Observatory Wireline Sonic Logs

Jul 21, 2026
6.32 MB
In progress
This data set includes wireline geophysical data from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 and to...
Authors
Tester, J. et al Cornell University
geothermalenergycornell universitycuboddudeep direct usedistrict heatingdeep wellwell datadrillingesh-1api 31109300030000raw dataappalachian basin

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Play Fairway Analysis Retrospective GeoRePORTs

Dec 01, 2020
28.78 MB
Publicly accessible
NREL, as part of the Play Fairway Analysis (PFA) Retrospective and with assistance from PFA PIs, completed GeoRePORTs for the sites identified in Phases 1&2 of the DOE PFA projects. The GeoRePORT (geothermal resource portfolio optimization and reporting technique) uses two factor...
Authors
Kolker, A. et al National Renewable Energy Laboratory
geothermalenergypfageoreportsrpsnake river plainidahoblindresourcecharacterizationwashingtonmshszmsh-nwrvwind river valleymount st. helensshear zonenorthwashington stateplay fairway analysishawaiilanaimauna keaegbeastern great basintwin peaksutahcove fortcrater knollmountain homenevadanevada great basingranite springs valleynorthernsou hillscrescent valleysouthern gabbs valleytularosa basinnew mexicoadf-sw/nasaadfaerospace data facilityfort blissmcgregor rangewsmrwhite sands missile rangemount bakercamas prairiepermeabilitydrillinglogisticsmarkettransmissionland access

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Publicly accessible
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Cornell University Borehole Observatory Wireline Geophysical Logs

Jul 21, 2026
8.84 MB
In progress
This data set includes wireline geophysical data from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 and to...
Authors
Tester, J. et al Cornell University
geothermalenergycornell universitycuboddudeep direct usedistrict heatingdeep wellwell datadrillingesh-1api 31109300030000raw dataappalachian basin

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data

EGS Collab Experiment 2: Core Photographs and Descriptions

Aug 05, 2021
136.42 GB
Publicly accessible
This submission contains photographs of rock core collected from EGS Collab Experiment 2 (and 3) boreholes. Cores were generally photographed in about 1-foot sections using Nikon D3300 DSLR cameras from two angles about 90 degrees apart, wet and dry. Core photos are provided here ...
Authors
Kneafsey, T. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 24100 levelsanford underground research facilitycore photographscoredrillinggeologysurfpanoramic photographscore logsanomaly logs

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Utah FORGE: Logs and Data from Deep Well 58-32 (MU-ESW1)

Apr 11, 2018
2.24 GB
Publicly accessible
Data, logs, and graphics associated with the drilling and testing of Utah FORGE deep test well 58-32 (MU-ESW1) near Roosevelt Hot Springs.
Authors
Nash, G. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutahgeothermal welltest welldrillinggeothermal drillingdrilling datawell testingwell test datafmi logsdsi logsgamma logsporositycaliper logsdaily reportstemperature logspressure logsisolation scannersonic logsmud logsdirectional surveypason logsborehole stresspt reportswell logsmu-esw158-32roosevelt hot springslogdatadeppwellcaliperegswell logtestingmilfordwell dataresourcecharacterizationtemperaturepressuredeep wellpason dataeowrend of well report

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing

Life Cycle Water Consumption and Water Resource Assessment for Utility-Scale Geothermal Systems: An In-Depth Analysis of Historical and Forthcoming EGS Projects

Aug 31, 2013
10.97 MB
Publicly accessible
This report is the third in a series of reports sponsored by the U.S. Department of Energy Geothermal Technologies Program in which a range of water-related issues surrounding geothermal power production are evaluated. The first report made an initial attempt at quantifying the li...
Authors
Schroeder, J. et al Argonne National Laboratory
geothermalegswaterlife cyclewater consumptionpowerregional water resource assessmentstimulationinternationaldomesticgeologypermitnevadaproductioninjectioncaliforniaoregonoperationalabovegroundmake-upcoolingwellobservation wellnepadrillingproduction wellinjection wellchemicalflow testcirculation testexploration welllossreservoir lossbelowground lossoperational lossloss ratelife cycle assessmentwater resource
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service