OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 50.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Well 56-32 location"×
Image×

Project HOTSPOT: Kimberly Well Core Photos

Jun 16, 2011
944.97 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalkimberlyproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Project HOTSPOT: Mountain Home Well Core and Drill Site Photos

Jan 11, 2012
937.4 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoyellowstone hotspotproject hotspotborehole geophysicsmountain homedrillingphoto core logdownhole geophysicsphotossrpcontinuous volcanismcore samplecore logwell datacore

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Utah FORGE: Optimization of a Plug-and-Perf Stimulation (Fervo Energy)

Feb 08, 2023
6.91 MB
Publicly accessible
Information around the plug-and-perf treatment design at Utah FORGE by Fervo Energy. Objective and Purpose: Develop a multistage hydraulic stimulation approach designed specifically to target the top three factors that control the technical and commercial viability of an EGS sys...
Authors
Norbeck, J. et al Fervo Energy
geothermalenergyutah forgeplug-and-perf stimulationwell stimulationfervo energyplug-and-perfplug and perffervotechnicalassessmentfeasibilityhydraulicstimulationinjection testprocessed datablue mountainnevadaegswell 73-22well 34a-22well 34-22near-field egshorizontal drillingproppantheat in placestate of stressfiber optic sensing

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Snake River Plain FORGE: Well Data for USGS-142

Nov 23, 2015
19.78 MB
Publicly accessible
Well data for the USGS-142 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, and photos of rhyolite core samples. This collection of data has been assembled as part of the site characterization data used to develop ...
Authors
Twining, B. Idaho National Laboratory
geothermalforgeegscore sample photosrhyolitelithologysrgcsnake river plainidahotempaddendumboreholelogusgs 142core samplesphotospresentationxrf datawhole rocktrace-element analysisignimibritethin sectionpetrographicimagesnatural gammagamma radiationtemperature profileneutron porositygamma-gammadensitywell logsrpcore samplecore photosmineralogypetrographygeologystratigraphic columnstratigraphyxrfsrg

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

Simulations of Brady's-Type Fault Undergoing CO2 Push-Pull: Pressure-Transient and Sensitivity Analysis

Mar 09, 2018
9.74 MB
Publicly accessible
Input and output files used for fault characterization through numerical simulation using iTOUGH2. The synthetic data for the push period are generated by running a forward simulation (input parameters are provided in iTOUGH2 Brady GF6 Input Parameters.txt [InvExt6i.txt]). In gene...
Authors
Jung, Y. and Doughty, C. Lawrence Berkeley National Laboratory
geothermalenergyegsco2carbon dioxidepush-pullpressure-transient testingitough2sensitivity analysisinverse modelingparameter estimationinconpesttough2fault modelinggf6bradyfaultingfaultfracturecharacterizationstimulation

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

GOOML Kahunanui Data Curation, Historical Modeling, Forecast Modeling, and Genetic Optimization Examples

Jan 30, 2023
725.34 MB
Awaiting release
This dataset contains example files and Jupyter Notebooks associated with the Geothermal Operational Optimization using Machine Learning (GOOML) framework, specifically for the fictional Kahunanui (KHN) geothermal power plant. The dataset includes synthetic time series data, confi...
Authors
Taverna, N. et al Upflow
geothermalenergymachine learninggoomlpower plantoptimizationgenetic optimizationregressionneural networkoperationssynthetic datakahunanuiforecasthindcastdata curationinputsoutputsconfigurationexamplephygnnphysics guided neural networkssteamfieldsteam fieldwellsflash plantsprocessed datapythonjupyter notebookmodelmodelingcode

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Reservoir Stimulation Optimization with Operational Monitoring for Creation of EGS

Sep 25, 2013
65.42 MB
Publicly accessible
EGS field projects have not sustained production at rates greater than half of what is needed for economic viability. The primary limitation that makes commercial EGS infeasible is our current inability to cost-effectively create high-permeability reservoirs from impermeable, igne...
Authors
A., C. Pacific Northwest National Laboratory
geothermalfracturing fluidmonitoringxmtnmracousticrheologypermeabilityegsigneous rock

Lost Circulation Materials in Geothermal Drilling: Single Fracture Clogging Experments

Jan 06, 2025
9.9 MB
In progress
The submitted dataset was generated by a series of laboratory fracture clogging (permeability reduction) experiments using commercially available materials used for lost circulation management during geothermal well drilling. The experiments were conducted using a permeability plu...
Authors
Lawrence Berkeley National Laboratory
geothermalenergydrillinglost circulation managementlost circulation materialsfractureclogginglaboratory experiment

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

Techno-Economic Simulation Results Using dGeo for EGS-Based District Heating in the Northeastern United States

Sep 30, 2024
3.1 MB
Publicly accessible
This dataset presents the results of techno-economic simulations performed using the Distributed Geothermal Market Demand Model (dGeo) to evaluate the feasibility of Enhanced Geothermal Systems (EGS)-based district heating in the Northeastern United States. Developed by the Nation...
Authors
Pauling, H. National Renewable Energy Laboratory
geothermalenergyegsdistrict heatingdgeoteatechno-economic analsyisfeasibilityegs feasibilityegs direct usedeep direct usedudducapexopexlcohmodelinggeothermal market demandmodelsimulationthermal demandheating demanddistrict heating networks

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Assessing Low-Temperature Geothermal Play Types: Relevant Data and Play Fairway Analysis Methods

Jan 01, 2023
17.19 MB
Publicly accessible
This data catalog contains information on low temperature geothermal play types. The U.S. Department of Energy (DOE) Geothermal Technologies Office (GTO) supports the Geothermal Heating and Cooling Geospatial Datasets and Analysis project, conducted by the National Renewable Energ...
Authors
Davalos, E. et al National Renewable Energy Laboratory
geothermalenergylow-temperaturedatasetsgeothermal heating and coolingdata cataloglow temperaturegeospatialgeochemicalprocessed datageophysicaleconomic riskdata repositoryplay fairway analysisplay fairwayalaskahawaiiunited statesexploration risktechnical reportreport

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis
<< Previous12
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service