OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 29.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"structure map"×
Image×

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

EGS Collab: 3D Geophysical Model Around the Sanford Underground Research Facility

Feb 06, 2019
14.13 MB
Publicly accessible
This package contains data associated with a proceedings paper (linked below) submitted to the 44th Workshop on Geothermal Reservoir Engineering. The Geophysical Model text file contains density, P and S-wave seismic speeds on a 3D grid. The file has six columns and provides latit...
Authors
Chai, C. et al Lawrence Berkeley National Laboratory
3d seismic structurejoint inversionblack hillssurfegs collab3dseismicmodelingmodelgeophysicsgeophysicaldensityvelocityspeedsanford underground research facilityinversionreservoir engineeringegscollabapiinteractivedata1dprofilemapvisualizationdepth2dp-waves-wave

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis

Enhanced Geothermal System (EGS) Suitability for Contiguous United States

Dec 01, 2025
527.64 kB
Publicly accessible
This data set includes maps of normalized LCOE all-in (Levelized Cost of Transmission [LCOT] inclusive) as calculated using NLR's Annual Technology Baseline (ATB) costs, both drilling and CAPEX/OPEX, and considering the best depth option (1-7 km) for each location across the conti...
Authors
Trainor-Guitton, W. et al National Laboratory of the Rockies
geothermalenergylcoelcotatbmapegsresource potentialcapexopexdrilling costsuitability maplevelized cost of transmissionlevelized cost of energyenhanced geothermalgeospatial dataraster datafavorabilityegs favorabilitymodel

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Publicly accessible
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Publicly accessible
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Geothermal Data Gap Analysis Over the Western US

Oct 01, 2020
12.79 MB
Publicly accessible
NREL, as part of the Play Fairway Analysis Retrospective, compiled and mapped publicly available geologic and geophysical data in relation to the 2008 USGS geothermal potential analysis. Included in this submission are maps displaying the publicly available data for LIDAR coverage...
Authors
Rhodes, G. and Roberts, B. National Renewable Energy Laboratory
geothermalenergydata gap analysisgeologic mappinggeophysicspfaplay fairway analysisusgsaeromagneticgravity stationgeologygeologicmapcoveragelidardata gap

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

West Flank Coso, CA FORGE Test Area

Nov 15, 2015
773.24 kB
Publicly accessible
A map with the Coso West Flank FORGE test area outlined, along with regional seismicity, the aeromagnetic data set and the area currently being utilized for the creation of the 3D model.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankforgegeographygeophysicscaliforniacososeismicityaeromagnetic

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Publicly accessible
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

SSGF Mineral Major Elements and Lithium Concentration

May 01, 2023
1.38 MB
Publicly accessible
Presented are major element and lithium concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is now being studied as a source of geothermal brine for lithium extr...
Authors
Humphreys, J. et al Lawrence Berkeley National Laboratory
geothermallithiummineralrockssalton sea geothermal fieldbrinelithium isotopteschloritegeologygeochemistryhydrothermalisotope quantificationextractionsalton sealithium valleygeothermal brineimperial countyraw data

DEEPEN 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jun 30, 2023
3.62 GB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. Part of the DEEPEN project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfamodellingmodelingcharacterizationexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponent

Utah FORGE: Seismic Velocity Models, February 2021

Feb 28, 2021
10.92 MB
Publicly accessible
This dataset contains a map, showing the Utah FORGE seismic stations, and seismic velocity model data. There are 61 1-D velocity models which are in a compressed TAR file. A paper is referenced at the end of this description which discusses the use of these data in 3D modelling. T...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismic data1d seismic velocityseismic velocityutah forgeforgeutah geothermalvelocity modelsseismicvelocityspacspatial auto-correlationpseudo-3dgeophonebayesian monte carlo inversionmodelingmodeldistributed acoustic sensinggeospatial datasedimentary basinwaveform inversionseismic noisegeophysicstaregsroosevelt hot springsutahmilford

Conductance Steamflow Relationship at Darajat Geothermal Field

Apr 01, 2015
176.45 kB
Publicly accessible
These histograms represent our calibration of conductance of a volcanic geothermal field (with a clay cap) and the observed steam flow rates. Darajat is a vapor geothermal field located in West Java, Indonesia. First production from the field was started in 1994 and additional cap...
Authors
Trainor-Guitton, W. Lawrence Livermore National Laboratory
geothermalconductancesteam flowprobabilistichistogramdarajatindonesiawest javavapor dominatedvolcanicelectrical conductanceprobability

SSGF Trace Element Concentrations

Jan 08, 2026
706.57 kB
Awaiting release
Presented are trace element concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is actively being studied as a source of geothermal brine for lithium extraction. ...
Authors
Kovalick, A. et al University of California Riverside
geothermaltrace elementssalton sea geothermal fieldrocksmineralhydrothermallithium valleygeothermal brineraw dataimperial countyssgfimperial valleyrare earth elementsreecritical mineralsmnznconibrine-rock reactionrock samplesbrine samplesrhyolitic domesdurmid hillsschmitt and hulenca 2-14wellschemistryfluid chemistrygeochemistrysalton sealithium extraction

Project HOTSPOT: Mountain Home Well Borehole Geophysics Database

Nov 11, 2012
209.37 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainproject hotspotidahoyellowstone hotspotborehole geophysicsmountain homegeophysicsborehole logdowhnhole geophysicstemperaturepressuregamma raymagnetic susceptibilitygeochemistrythoriumuraniumpotassiumneutronresistivityimage logsrpboreholewell data

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

Project HOTSPOT: Mountain Home Well Core and Drill Site Photos

Jan 11, 2012
937.4 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoyellowstone hotspotproject hotspotborehole geophysicsmountain homedrillingphoto core logdownhole geophysicsphotossrpcontinuous volcanismcore samplecore logwell datacore
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service